KEGG   Caldicellulosiruptor owensensis: Calow_0717Help
Entry
Calow_0717        CDS       T01347                                 

Definition
(GenBank) thiamine pyrophosphate TPP-binding domain-containing protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00010  Glycolysis / Gluconeogenesis
cow00020  Citrate cycle (TCA cycle)
cow00620  Pyruvate metabolism
cow00633  Nitrotoluene degradation
cow00640  Propanoate metabolism
cow00650  Butanoate metabolism
cow00680  Methane metabolism
cow01100  Metabolic pathways
cow01120  Microbial metabolism in diverse environments
cow01130  Biosynthesis of antibiotics
cow01200  Carbon metabolism
Module
cow_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_0717
   00020 Citrate cycle (TCA cycle)
    Calow_0717
   00620 Pyruvate metabolism
    Calow_0717
   00640 Propanoate metabolism
    Calow_0717
   00650 Butanoate metabolism
    Calow_0717
  Energy metabolism
   00680 Methane metabolism
    Calow_0717
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calow_0717
Enzymes [BR:cow01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calow_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADQ04289
UniProt: E4Q5J4
Position
821164..822102
Genome map
AA seq 312 aa AA seqDB search
MAYNIKELATRPERFTGGHRMCAGCGAPVAVRAILRALKPEDRAVVGVATGCLEVSSCIY
PYTAWKDSFIHSAFENAAATVSGAEAAYRVLKKKGKVQGEFKFIAFGGDGGTYDIGLQSL
SGAMERGHNMVYVCYDNGAYMNTGIQRSSATPLYADTTTSPQGKVLPGKMQPRKDLTEVM
VAHGIPYVAQTAFITPNLKDLIEKAEKALYTDGPAFLNVLAPCPRGWRYETSKLIEISKL
AVDTCFWPLYEVVNGQYRLTYKPKEKLPVVEFLKTQGRFRHLFKKGNEHLIEQIQQEVDR
RWERLLELCGEK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcatacaatataaaggagcttgctactagacctgaaagatttacaggtggacacaga
atgtgtgctgggtgcggtgcacctgttgctgtaagagcaatactgcgcgcactgaaaccc
gaagatagagctgttgtaggtgttgcaacaggatgtttggaggtttcaagctgtatctat
ccatatacagcatggaaagattcatttattcacagtgcatttgaaaatgctgctgcaaca
gtttctggtgctgaggctgcatatagagttttgaagaaaaagggaaaagtacagggagag
tttaagttcatcgcgtttggtggcgacggtggaacatacgatattggtcttcagtctctt
tcgggtgcaatggaaagagggcataacatggtatatgtttgttatgacaacggtgcttat
atgaacacaggtatccagagatcttctgctacaccactttatgctgatacaacaacatct
ccacagggcaaggttttaccaggtaagatgcagccaagaaaagaccttacagaagttatg
gttgcacatggtataccatatgttgctcaaacagctttcattactccaaacctcaaagat
ttaattgaaaaggctgaaaaggcactttacacagatggaccagcatttttgaatgttttg
gcgccatgtccaagaggttggagatatgaaacatcaaagctaattgaaatttcaaagctt
gcagtggatacatgtttctggccactttatgaagttgtaaatggtcagtacaggcttact
tacaagccaaaagaaaaacttcctgttgttgagtttttaaagactcaaggaaggttcaga
cacctgtttaaaaaagggaatgaacatttaattgaacaaattcagcaggaagttgacaga
agatgggaaaggcttctggaactttgcggtgagaaataa

DBGET integrated database retrieval system