KEGG   Caldicellulosiruptor owensensis: Calow_0927Help
Entry
Calow_0927        CDS       T01347                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calow_0927
  Lipid metabolism
   00561 Glycerolipid metabolism
    Calow_0927
   00600 Sphingolipid metabolism
    Calow_0927
Enzymes [BR:cow01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Calow_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1016523..1017839
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRDSTIALMDIDSIRLEFMKKALQKLIDQEKYP
TKLEATTDRKEALKGAKYVIVTIQVGGLKPYEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTIPVLLDIAKDMGELCPDALLLNYVNPMAMNCWALNKATNIKNVGLCHSVQGTAEFLAK
IIGAKMEEISYLCAGINHMAWFLKFEWNGKDAYPLIREKANDPEIYTQDVTKFEILKHFG
YYVSESSFHMSEYVPYFRKSDDWINRIHKTHSWHKEHYNGMYLHCCLDAAKTLLEDLKKM
AEADYIDPKRSNEYCATIIHSIETNTPSVINGNVENKGLITNLPEGCCVEVPCLVDRNGI
QPTYVGNLPPQLAALNRTNINVQELAVIAALTGDREAVYHAIMMDPLTSAVLDLDQLRQM
VDEMFEAEKEWLPDGFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggtgcaggaagtggagttttcacaagaaacctggtaaga
gacattttgtcgtacccagagttaagagactctacaatagcgcttatggacattgatagt
ataaggcttgaatttatgaaaaaagctttgcaaaaactcattgatcaggaaaagtatcca
accaaacttgaagccacaactgatagaaaagaagctctaaaaggtgcaaaatatgtgatt
gtcacaatacaagttggaggtttaaaaccttacgaatatgacatttacattcctctaaaa
tatggtgtaaaacaggcagttggtgatacaataggtccaggtggggttttcagggctctt
agaacaataccagttttgcttgacattgcaaaggacatgggagagctgtgtccagatgct
cttcttcttaactatgtaaatccaatggcaatgaactgctgggcgttaaataaagctacg
aatataaaaaatgtagggctttgtcatagtgttcaaggaactgcagaatttttagcaaag
attattggtgcaaagatggaagagatttcatacttatgtgcaggtataaaccacatggca
tggtttttaaaatttgagtggaatgggaaagatgcatatcctcttataagggaaaaagca
aatgatccagaaatctatacgcaggatgttactaaattcgagatattaaagcattttggg
tattatgtttcagagtcaagttttcacatgtctgaatatgttccctattttcgaaagagc
gacgattggataaatagaatccataaaacccattcatggcacaaagaacattacaatggc
atgtatctacactgttgcttggatgctgcaaaaacattacttgaagacctgaagaagatg
gcagaggcagactatattgatccgaaaagaagtaacgaatactgtgcaactatcattcat
tcaatagagacaaatacgccaagcgtaataaatggtaatgttgagaacaaggggttgata
acaaatctacctgaaggatgctgcgtagaagtaccatgtttggttgacagaaatggtatt
cagccaacttatgttggaaatcttccaccacagcttgcagctttaaacagaacaaatata
aatgttcaagagcttgctgtaattgctgctttgacaggtgatagggaggcagtctatcat
gcgattatgatggaccctctcacaagtgctgttttggatttagaccaactacgtcagatg
gttgatgagatgtttgaagctgaaaaagaatggctgccagatgggttttataggtaa

DBGET integrated database retrieval system