KEGG   Caldicellulosiruptor owensensis: Calow_0927Help
Entry
Calow_0927        CDS       T01347                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cow00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cow00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cow00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1016523..1017839
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRDSTIALMDIDSIRLEFMKKALQKLIDQEKYP
TKLEATTDRKEALKGAKYVIVTIQVGGLKPYEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTIPVLLDIAKDMGELCPDALLLNYVNPMAMNCWALNKATNIKNVGLCHSVQGTAEFLAK
IIGAKMEEISYLCAGINHMAWFLKFEWNGKDAYPLIREKANDPEIYTQDVTKFEILKHFG
YYVSESSFHMSEYVPYFRKSDDWINRIHKTHSWHKEHYNGMYLHCCLDAAKTLLEDLKKM
AEADYIDPKRSNEYCATIIHSIETNTPSVINGNVENKGLITNLPEGCCVEVPCLVDRNGI
QPTYVGNLPPQLAALNRTNINVQELAVIAALTGDREAVYHAIMMDPLTSAVLDLDQLRQM
VDEMFEAEKEWLPDGFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggtgcaggaagtggagttttcacaagaaacctggtaaga
gacattttgtcgtacccagagttaagagactctacaatagcgcttatggacattgatagt
ataaggcttgaatttatgaaaaaagctttgcaaaaactcattgatcaggaaaagtatcca
accaaacttgaagccacaactgatagaaaagaagctctaaaaggtgcaaaatatgtgatt
gtcacaatacaagttggaggtttaaaaccttacgaatatgacatttacattcctctaaaa
tatggtgtaaaacaggcagttggtgatacaataggtccaggtggggttttcagggctctt
agaacaataccagttttgcttgacattgcaaaggacatgggagagctgtgtccagatgct
cttcttcttaactatgtaaatccaatggcaatgaactgctgggcgttaaataaagctacg
aatataaaaaatgtagggctttgtcatagtgttcaaggaactgcagaatttttagcaaag
attattggtgcaaagatggaagagatttcatacttatgtgcaggtataaaccacatggca
tggtttttaaaatttgagtggaatgggaaagatgcatatcctcttataagggaaaaagca
aatgatccagaaatctatacgcaggatgttactaaattcgagatattaaagcattttggg
tattatgtttcagagtcaagttttcacatgtctgaatatgttccctattttcgaaagagc
gacgattggataaatagaatccataaaacccattcatggcacaaagaacattacaatggc
atgtatctacactgttgcttggatgctgcaaaaacattacttgaagacctgaagaagatg
gcagaggcagactatattgatccgaaaagaagtaacgaatactgtgcaactatcattcat
tcaatagagacaaatacgccaagcgtaataaatggtaatgttgagaacaaggggttgata
acaaatctacctgaaggatgctgcgtagaagtaccatgtttggttgacagaaatggtatt
cagccaacttatgttggaaatcttccaccacagcttgcagctttaaacagaacaaatata
aatgttcaagagcttgctgtaattgctgctttgacaggtgatagggaggcagtctatcat
gcgattatgatggaccctctcacaagtgctgttttggatttagaccaactacgtcagatg
gttgatgagatgtttgaagctgaaaaagaatggctgccagatgggttttataggtaa

DBGET integrated database retrieval system