KEGG   Caldicellulosiruptor owensensis: Calow_0930Help
Entry
Calow_0930        CDS       T01347                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cow00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calow_0930
Enzymes [BR:cow01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Calow_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1019072..1019665
Genome map
AA seq 197 aa AA seqDB search
MIDSIVGTIQEVFSNYVILNYNNLYIKIHCNGAKFSEFLGKEKRVYVSLKFNENLSELEC
YGFLTREERELFLKLQKVTGVGSKLALQILASIDFQELIVEIAKGNVARLEKVKGIGKKT
ASRIILELKETLKKEFKVAATTGKEEKTYEKLEEISLALLSLGYDIDEVNQVLSSGDFSE
LSLEDGIKLALKKLSKI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatagattctattgtgggaaccatccaagaggtatttagtaactatgttatcctcaat
tataacaatttatacataaaaatacattgtaatggcgcaaaattttctgaatttttaggc
aaagaaaagagagtgtatgttagcctaaagtttaatgaaaatttatcagagcttgaatgt
tatggttttttgacaagagaggaaagagaactttttttaaagcttcagaaggtaactggt
gttggtagcaaattagctcttcagattctcgcctcaatagactttcaagagcttattgtt
gagattgcaaagggaaatgtggcaagacttgagaaggtaaaaggaattggaaaaaaaact
gcaagcaggataattcttgaactcaaagagacactcaaaaaagagtttaaagtggctgcc
actacaggtaaagaagaaaaaacttacgaaaaacttgaagaaatctctttagcactttta
tccttggggtatgacattgatgaagtcaaccaggttctttcatccggagatttttctgaa
ctttctttggaagatgggataaaacttgctttgaaaaagttatcaaagatttga

DBGET integrated database retrieval system