KEGG   Caldicellulosiruptor owensensis: Calow_0964Help
Entry
Calow_0964        CDS       T01347                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00040  Pentose and glucuronate interconversions
cow00052  Galactose metabolism
cow00500  Starch and sucrose metabolism
cow00520  Amino sugar and nucleotide sugar metabolism
cow01100  Metabolic pathways
cow01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calow_0964
   00052 Galactose metabolism
    Calow_0964
   00500 Starch and sucrose metabolism
    Calow_0964
   00520 Amino sugar and nucleotide sugar metabolism
    Calow_0964
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Calow_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ADQ04530
UniProt: E4Q6U7
Position
1051013..1051921
Genome map
AA seq 302 aa AA seqDB search
MKRLIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGR
GKRAIEDHFDKSFELEVALENKKDYDNLQLIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISEKPCLKQLIEVYEEYRTTILGVQKVPEDDVSKYGIIAGKQIED
RIYKVKDLVEKPKKEESPSNIAVLGRYIITPEILNILQHTKEGVGGEIQLTDALRELSKK
EAMYAYEFEGRRYDVGNKLGFLQATVEIALSREDIGRDFYNYLVTLVNAKNYKEKLSELE
KI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacttatcaaaaaagccatcattcctgcagcaggacttggtacaaggttttta
ccggcaacaaaagcacagccaaaagagatgcttcccattgtggacaagccaacaattcag
tacatagttgaagaggcgttagagtcggggatagagagtatcctaattgttacagggcgt
ggcaaaagagctattgaagatcattttgataagtcttttgagcttgaagttgctcttgaa
aacaaaaaggattatgacaatctccagctaataagaaagatagcagactataatgtccac
tatatacgccaaaaagaaccaagaggccttggtgatgcagtttactgtgcaagacttttt
attgacaatgaaccttttgcagttctacttggcgacgacatcatcatttccgaaaagcca
tgtttaaaacagctaatagaggtgtatgaagagtacagaacaaccatcttgggtgtccaa
aaagtaccagaggatgatgtcagcaagtatggaattattgcaggtaagcaaatagaagat
agaatctacaaggtaaaagaccttgtagaaaagcctaaaaaagaagaatcaccttcgaat
attgctgtgcttggaagatatatcatcactcctgagatattaaatatcctacagcacaca
aaagagggtgttggtggagaaatacagttgactgacgccttgagagaactttctaaaaaa
gaagctatgtatgcttatgaatttgaaggaagaagatatgatgtgggcaacaaacttggg
ttcctgcaggcaacagtcgagattgctctttcaagagaagacattggtagagatttttat
aactatcttgttactcttgtgaatgctaagaattacaaagaaaaactaagtgagttagaa
aagatttaa

DBGET integrated database retrieval system