KEGG   Caldicellulosiruptor owensensis: Calow_1056Help
Entry
Calow_1056        CDS       T01347                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00010  Glycolysis / Gluconeogenesis
cow00030  Pentose phosphate pathway
cow00051  Fructose and mannose metabolism
cow00052  Galactose metabolism
cow00680  Methane metabolism
cow01100  Metabolic pathways
cow01110  Biosynthesis of secondary metabolites
cow01120  Microbial metabolism in diverse environments
cow01130  Biosynthesis of antibiotics
cow01200  Carbon metabolism
cow01230  Biosynthesis of amino acids
cow03018  RNA degradation
Module
cow_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_1056
   00030 Pentose phosphate pathway
    Calow_1056
   00051 Fructose and mannose metabolism
    Calow_1056
   00052 Galactose metabolism
    Calow_1056
  Energy metabolism
   00680 Methane metabolism
    Calow_1056
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Calow_1056
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calow_1056
Protein phosphatases and associated proteins [BR:cow01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calow_1056
Messenger RNA biogenesis [BR:cow03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Calow_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADQ04619
UniProt: E4Q160
Position
1142585..1143553
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKYGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKEEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKSIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggagacgcaccaggaatgaac
gctgctatacgtgctgttgtgagaactggtatatactatgggtttagagtgatgggtata
agacgcgggtataacggtcttattgaaggtgacatttttgagatgaacctgaggtctgtt
tcagatataatccaacgtggtggaacaatacttttgactgcaaggtctcctgagtttatg
acagaaaatgggcttaaaaaagctgcttcaatgtgcaagatattcaagattgatgctctt
gtcgtaattggtggagacgggtctttcagaggagcaagagatttgagtaaatatggtatt
aatgttgttgggattcctggaaccattgataatgatattgcatgtacagattacacaata
ggttttgatacagcattgaatactgtacaggatgcaattaacaagataagggacacagca
acttcccatgaaagggttagtattcttgaagtaatggggcgtcatgctggatatatagct
ctttacagtggtattgcaggaggagcagagtcaatagtaattcctgaaaaaggtcttgat
aaggaggagataatcagaagaataattgatggcaaaaacaaaggaaagttacacaacttg
attatattagctgagggaattggtggagcaacagagcttgcaaaggagattgaagaagca
acgggaatagagacaagagcgaccatccttgggtatatccagagaggtggttcaccaact
gcgtatgacagagttgttgcaagtttgatgggagcaaaagctgttgaggttatcaaagaa
gggaagcagaacaggataattgcaatgaaggatggtaagattgttgattatgatattgac
gaagcactttctatgcaaaagtcaattgatgagtacatgtacaacttagctactattctt
tctttataa

DBGET integrated database retrieval system