KEGG   Caldicellulosiruptor owensensis: Calow_1056Help
Entry
Calow_1056        CDS       T01347                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calow_1056
   01230 Biosynthesis of amino acids
    Calow_1056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_1056
   00030 Pentose phosphate pathway
    Calow_1056
   00051 Fructose and mannose metabolism
    Calow_1056
   00052 Galactose metabolism
    Calow_1056
  Energy metabolism
   00680 Methane metabolism
    Calow_1056
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calow_1056
Protein phosphatases and associated proteins [BR:cow01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calow_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1142585..1143553
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKYGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKEEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKSIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggagacgcaccaggaatgaac
gctgctatacgtgctgttgtgagaactggtatatactatgggtttagagtgatgggtata
agacgcgggtataacggtcttattgaaggtgacatttttgagatgaacctgaggtctgtt
tcagatataatccaacgtggtggaacaatacttttgactgcaaggtctcctgagtttatg
acagaaaatgggcttaaaaaagctgcttcaatgtgcaagatattcaagattgatgctctt
gtcgtaattggtggagacgggtctttcagaggagcaagagatttgagtaaatatggtatt
aatgttgttgggattcctggaaccattgataatgatattgcatgtacagattacacaata
ggttttgatacagcattgaatactgtacaggatgcaattaacaagataagggacacagca
acttcccatgaaagggttagtattcttgaagtaatggggcgtcatgctggatatatagct
ctttacagtggtattgcaggaggagcagagtcaatagtaattcctgaaaaaggtcttgat
aaggaggagataatcagaagaataattgatggcaaaaacaaaggaaagttacacaacttg
attatattagctgagggaattggtggagcaacagagcttgcaaaggagattgaagaagca
acgggaatagagacaagagcgaccatccttgggtatatccagagaggtggttcaccaact
gcgtatgacagagttgttgcaagtttgatgggagcaaaagctgttgaggttatcaaagaa
gggaagcagaacaggataattgcaatgaaggatggtaagattgttgattatgatattgac
gaagcactttctatgcaaaagtcaattgatgagtacatgtacaacttagctactattctt
tctttataa

DBGET integrated database retrieval system