KEGG   Caldicellulosiruptor owensensis: Calow_1106Help
Entry
Calow_1106        CDS       T01347                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Calow_1106
Enzymes [BR:cow01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Calow_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1190756..1191613
Genome map
AA seq 285 aa AA seqDB search
MSFNFYKPFFLCASEKYEDSQIVLAGIPMDFTVSFKPGSRFAPAKIREVSIELEEYSIYQ
DKSLYDKTFCDMGDLELPFGNIERSIETIYQFACKLFEDKKVPIFLGGEHLISFPLIKAA
ANSNDGEFYVLHFDAHADMREEYIGEKFSHATVMRRVGEVIGFKNIYHFGIRSGSKEEIE
FAKKNSNLYFVDKWGKIDDVIKNLKSKKVYLSIDIDVFDPAFAPGTGTPEPGGILSSDFF
DILLKLKDLDIIGADIVEVAPYYDISDRTALLAAKIVRELILMMK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaatttctacaaaccctttttcctgtgtgcttcagaaaagtatgaagatagt
caaatagttttagcaggaattcctatggatttcacagtaagctttaaacctggttcgcgt
tttgctcctgcaaaaataagagaagtgtcaatagagctggaagagtattctatctatcag
gacaaaagcctgtatgacaagactttttgtgatatgggtgatctggaacttccttttgga
aacatcgaaagaagtattgaaacaatataccaatttgcttgtaagctgtttgaagataaa
aaagtccctattttcttaggcggtgaacatctgatcagctttcctctaataaaagcggcg
gcaaactcaaatgatggggagttttatgtacttcactttgatgctcatgctgatatgaga
gaggagtatattggtgaaaagttttcacatgccactgtgatgagaagagtgggtgaggta
ataggttttaagaatatataccacttcggtataaggtctgggtctaaagaagaaattgaa
tttgcaaaaaagaatagcaatctttattttgttgacaaatggggtaaaattgatgatgta
ataaaaaatttaaaaagcaagaaggtatatctttcgatagatatagatgtttttgatccg
gcttttgcccctggtacaggaacacctgaaccaggtggaattctatcttcggactttttt
gacattttacttaaattaaaggaccttgatataataggagctgacatagtagaagttgca
ccatattatgatatttctgacagaacagcactgcttgctgcaaaaatagtaagagagcta
atattgatgatgaagtaa

DBGET integrated database retrieval system