KEGG   Caldicellulosiruptor owensensis: Calow_1163Help
Entry
Calow_1163        CDS       T01347                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Calow_1163
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Calow_1163
Enzymes [BR:cow01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Calow_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1244674..1245591
Genome map
AA seq 305 aa AA seqDB search
MKHLLGLKELSKEDIIKILNLAKDMKTILKSETKKTPHLQGYSVVTLFYENSTRTRTSFE
LAAKFMSANTTSISVQTSSVQKGESLLDTVKTLEALKTDVLIVRHSVSGVPHFIAKNCSF
SVINAGDGMNEHPTQALLDMFTIRERLGTIEKLKIAIIGDILHSRVARSNIWGLSKFDNQ
ITVFGPQTLIPPYIENFAKVASSLEEAVSGKDVVIDLRIQLERQKRGFITSKQEYYKFYG
LNEDIMRYISGSTMIMHPGPVNRGVEISSEVMQLPNSTIEEQVTNGIAVRMAVLYLCTRK
EGIYR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttgcttgggctaaaagagctttcaaaagaggatatcataaaaatactgaat
cttgcaaaagatatgaagacaattttaaagagtgaaaccaaaaagactccacatcttcaa
ggatattcggttgtaaccctgttttatgaaaatagcaccagaacacgaacatcgtttgaa
cttgcagcaaagtttatgagtgcaaatacaacctctatatctgtgcaaaccagcagtgtg
cagaaaggagagtctttgcttgatactgtaaaaactttggaagctttaaaaacagatgtg
ctaattgtcagacattcagtttctggtgtgccgcattttattgctaaaaactgctcattt
tcggtcataaacgctggtgatggaatgaatgaacatccaacacaggcactacttgatatg
ttcacaattagagaaaggcttgggacaattgagaaattgaagatagcaatcattggcgat
attcttcacagtagggttgcaaggagcaacatatgggggctttctaagtttgataaccaa
atcacagtgtttggaccacaaacgctaattccaccttatattgaaaactttgctaaagtt
gcatcctctttggaagaggcagtctcaggaaaagatgttgtaatagatttgaggattcag
cttgagagacaaaaaagaggtttcataacctcaaaacaagagtattacaagttttatgga
ttaaacgaagatataatgaggtatatttcaggcagcaccatgataatgcatcctggtcct
gtcaacaggggagttgaaatttcttcagaggtgatgcagctgccaaattctacaattgaa
gagcaggttacaaacggtattgctgttagaatggcagttttatacctttgcactcgcaag
gagggaatttacaggtga

DBGET integrated database retrieval system