KEGG   Caldicellulosiruptor owensensis: Calow_1430Help
Entry
Calow_1430        CDS       T01347                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calow_1430
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calow_1430
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calow_1430
Enzymes [BR:cow01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calow_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1511152..1511922)
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFEKLKKEGKKAFIGYVTFGYPSFEETLDYIKLVYSYVDILEIGFPFSDPIADG
EIIQKASRKALSEGVKLNHLFESIEKFKKDKPVVLMLYANTVYKRGIDRFFESSKTCGVD
GVIIPDVSFEESFEFKEVAEKFGIVYIDLVSISSLERAKMIGRQSRGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVQKFKDLADGIVIGSAIITKIDEGKG
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaaggtttgaaaagctaaaaaaagagggaaaaaaagctttcata
ggctatgttacgtttgggtatccctcttttgaagagacacttgattatataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagacgga
gagattattcaaaaggcctcaagaaaagctctcagtgaaggtgttaaattgaaccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgctgtatgcaaac
acagtttacaaaaggggaattgatagattttttgaaagtagcaaaacttgcggtgtggat
ggcgtgataatccccgatgtttcgtttgaagagagctttgagttcaaagaagtagctgaa
aagtttggtattgtctatatagaccttgtatcaatatcttctcttgaaagagccaagatg
ataggtaggcagagccgtggttttttgtattgtgtttcaagaaaaggtgtgacaggtttc
aaagggcagattgatgataggatttttacttttctaaaagaactaaagactgtaacctca
acacctttggcagttggatttggtataaagagtaaagaagatgtacaaaagttcaaagac
cttgcagatggtattgtcattggaagtgcaataatcacaaagatagatgaaggaaaaggc
aaacttgaggattttttgaaagaaatctcagaaagtctaaaagacaaataa

DBGET integrated database retrieval system