KEGG   Caldicellulosiruptor owensensis: Calow_1451Help
Entry
Calow_1451        CDS       T01347                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00010  Glycolysis / Gluconeogenesis
cow00020  Citrate cycle (TCA cycle)
cow00620  Pyruvate metabolism
cow00633  Nitrotoluene degradation
cow00640  Propanoate metabolism
cow00650  Butanoate metabolism
cow00680  Methane metabolism
cow01100  Metabolic pathways
cow01120  Microbial metabolism in diverse environments
cow01130  Biosynthesis of antibiotics
cow01200  Carbon metabolism
Module
cow_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_1451
   00020 Citrate cycle (TCA cycle)
    Calow_1451
   00620 Pyruvate metabolism
    Calow_1451
   00640 Propanoate metabolism
    Calow_1451
   00650 Butanoate metabolism
    Calow_1451
  Energy metabolism
   00680 Methane metabolism
    Calow_1451
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calow_1451
Enzymes [BR:cow01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calow_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_6 Fer4_7 Fer4_16 Fer4_9 Fer4_2 Fer4_21 Fer4_10 Fer4_17 Fer4_4 Fer4_8 Fer4_22 Fer4_13 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADQ04998
UniProt: E4Q2Y0
Position
complement(1534016..1535035)
Genome map
AA seq 339 aa AA seqDB search
MLTTTNELGYYEIRLESIGGLGANVAGKILAEAGVIGSGLNALNFASYGSEKKGSPVKSY
IRFAPKEKQIRINSPVVQPHLVAIFHENMVNTNPVTQGLRKDGIVILNTSKSVDEARDFL
KLASGTVATVDAIRIALEVKTRINMVMLGAIVRMLGFISLDSVKEVIKQTFEKKYPQTIA
SNLAGLEAGYNQVESKFFEYDGKYQYVEYQEERRPMGYKNAPIGGTIVEYANTITKNNMT
SRIGKIPVFVKEKCINCGLCETTCPDYVFVWDRIIENGKPKMINMGLDYQYCKGCLRCVD
ICPAGALVEGIEREYDIEKISAKHDFDIYEKWYEDGEKR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttaactactacgaacgaacttggatattacgaaatccgacttgaaagtattggcgga
cttggtgcaaatgttgcgggcaagattttggctgaggcaggtgttattggaagtggactg
aatgccttaaattttgcaagttatggctctgaaaagaagggttcaccagtaaagtcgtat
ataagatttgctcccaaggaaaagcagataagaattaattcgcctgttgttcagcctcat
ttggttgctatatttcacgagaatatggtaaatacaaatcctgtcacacaaggacttaga
aaagacggaatagttatcctgaacactagcaagagtgtggatgaagctcgagatttttta
aagcttgcaagtggcacggtggcaacagtggatgcaataaggattgcacttgaagttaaa
acaaggattaacatggttatgttaggagcgattgtaagaatgcttgggtttatcagctta
gatagcgtgaaagaggttattaaacaaacttttgagaaaaaatatccacagacaattgcg
tccaacctggcgggtcttgaagctgggtataaccaggtagaatctaagttttttgaatat
gatggtaaataccaatacgtagagtaccaggaagaaagaaggcctatgggatataaaaac
gctccaattggaggaactattgttgagtatgcaaacacaataacaaagaacaatatgacc
agcaggattgggaaaattcctgtatttgtaaaggagaaatgtataaactgtgggctttgt
gaaactacatgccctgattatgtctttgtttgggataggataatcgaaaatggaaaacca
aaaatgataaacatgggattagactatcaatattgcaaaggatgtttgagatgtgttgat
atttgtcctgcaggtgcacttgttgaaggaattgaaagggaatatgacatagaaaagatc
tctgcaaaacatgattttgatatatacgaaaagtggtatgaggatggtgagaaaagatga

DBGET integrated database retrieval system