KEGG   Caldicellulosiruptor owensensis: Calow_1555Help
Entry
Calow_1555        CDS       T01347                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00900  Terpenoid backbone biosynthesis
cow01100  Metabolic pathways
cow01110  Biosynthesis of secondary metabolites
cow01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Calow_1555
Enzymes [BR:cow01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Calow_1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Epimerase
Motif
Other DBs
NCBI-ProteinID: ADQ05101
UniProt: E4Q3M1
Position
complement(1621613..1622779)
Genome map
AA seq 388 aa AA seqDB search
MTKKICILGSTGSIGVQTIDVAKKLGIRVVGLSANKNVDLLIKQARELNPDILCIVDEKY
YAILKENFPDKIVVAGQKGLISVATYPAADLIVNALVGVSGLVPTVEAILAGKRVALANK
ETLVTGGKIIKRILSQKQAKDSLPLLIPVDSEHSAIFQCLVGEDKKNVKKIILTASGGPF
RGKKLKDLQSVNVEDVLKHPTWNMGKKITVDSATLINKGFEVIEAMFFFDKRCDDIDVVI
HPQSIVHSMVEFVDGAIKAQLSYPDMRLPIEYALTFPERSREIVMPLELTKIKNLTFEEP
DFDTFFLLKIAYECAKKGESYPIVLNAANEEAVKYFLERKIGFVDIMNYVTKIIERHREQ
KVESIQDILEIDAEARQKFKNLVEGEKN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagatatgcatcttagggtcaaccgggtccataggtgttcagacaatagat
gttgctaaaaaacttggaattagagttgtgggtctttcagcgaacaaaaatgtagatctt
ttgattaagcaagcaagagagcttaaccctgacattttatgtattgtagatgagaaatac
tatgctatattgaaagaaaattttcctgataagatagttgtagcaggtcagaaaggacta
attagtgttgcaacatatccagcagcagatttgatcgtaaatgctcttgttggtgtatct
ggtttagtgccgacagttgaggctattttggcaggcaaaagagttgctcttgctaacaaa
gagacacttgtgacaggtggaaagattataaaaaggattctttcccaaaaacaagcaaaa
gattctctccctcttcttattcctgttgattcagagcacagtgctatttttcagtgccta
gtaggtgaagacaaaaaaaatgtaaaaaagataattctcacagcatcgggagggcctttc
agaggcaaaaaactcaaagacttgcaaagtgtcaatgtggaagatgtgctgaagcatcct
acatggaacatgggcaagaaaatcacagttgattctgcaacgcttataaacaaaggcttt
gaagtgatagaagccatgtttttctttgataaaagatgtgatgatattgatgttgttata
catcctcagagtattgttcattcaatggttgaatttgttgatggggctataaaagcacag
ctatcttatcctgatatgcgccttccgattgagtatgcgcttacttttcctgaaagaagc
agagaaatagttatgccactcgagcttacaaaaataaaaaatcttacatttgaagaacct
gattttgatacattctttttgctcaaaattgcatatgagtgtgcaaaaaaaggagaaagt
tacccgattgtgctaaacgctgccaatgaggaggctgtaaaatatttcttggaaaggaaa
attggctttgttgatattatgaactatgtaactaaaattattgaaagacacagagagcaa
aaggtggaatccattcaagacattttggaaatcgacgcagaggcaaggcagaagtttaaa
aatcttgtggaaggtgagaaaaactaa

DBGET integrated database retrieval system