KEGG   Caldicellulosiruptor owensensis: Calow_1568Help
Entry
Calow_1568        CDS       T01347                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calow_1568
   01230 Biosynthesis of amino acids
    Calow_1568
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_1568
   00030 Pentose phosphate pathway
    Calow_1568
   00051 Fructose and mannose metabolism
    Calow_1568
   00052 Galactose metabolism
    Calow_1568
  Energy metabolism
   00680 Methane metabolism
    Calow_1568
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Calow_1568
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calow_1568
Protein phosphatases and associated proteins [BR:cow01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calow_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634425..1635672
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVVAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYIKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAQKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALASKDIGAPDLIYLPEVPFSIEKFLDDVRNIHKKTGKITI
VVSEGIKDREGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKSIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVRYAVEGACGYMVAIKRDSDNPYSSSTELVELNKVANAE
KLVPLAWISHDGNYVKEDALNYIQPLIEGEVEVKYEKGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagaaggtaactgcgtggttgcacaatcgggtggaccaactgctgtcatcaac
gcatcgcttttgggtgttattgaagaagccatgaaacagcatccgatccgtgccatttat
ggtgctaaaaatggaattattggtcttattgatgaggaactttatgacctcagaatggaa
gatcctgaagagctaaaacttttaaagacaactccatcatctgcactgggctcttgcagg
tatcagctcaagccttttgaacatgatgaaaaggactatattaagattttcaatgtattt
gaggcacacaacatccgctactttttctatataggcggaaacgactcaatggatacagct
gacaaattaacacgatacgcacaaaagattgggtatgacatctgcataatcggaattcca
aagacaatcgacaacgaccttgtgatgacagaccattgcccgggttttggaagtgctgca
aaatacatcgcaacatctgtgatggaaattgcaagagatgcagtggtgtacccaacaaat
attgttactataatcgaagtgatggggagaaacgctggctggcttgcagcagcatctgca
ctggcgtctaaagatataggggcaccagatttaatataccttcctgaagttccattttca
attgaaaagtttttggatgatgtaagaaacattcataaaaagacaggtaaaattaccatt
gtggtttcagagggtataaaagacagggaaggaaagtatattgctgatatgagccacaag
tttggaatagatgcgtttggacatgtacagcttggcggagcagcatttgttttagaaaac
attatccgtgaagaagtagaaaagagagtaaaatcaattcaattcaacgtactgcagcgc
agtgctgctcatatcatgtctaaaactgatgtggaagaagcgtacatggtcggacgcatg
gcagtaaggtatgcagttgaaggtgcttgcggatacatggtagcaataaaacgtgacagt
gacaatccttattcaagttcgacagagcttgttgaactgaacaaagttgcaaatgcagaa
aagcttgttccacttgcgtggatttcacatgacggtaactacgtaaaagaagatgcttta
aattatattcaaccccttattgaaggtgaagttgaagtcaagtacgaaaaaggtcttcct
cgatatgcaaaactcagaaagataatggtgccaaagaaagttgtataa

DBGET integrated database retrieval system