KEGG   Caldicellulosiruptor owensensis: Calow_1870Help
Entry
Calow_1870        CDS       T01347                                 

Definition
gid protein (EC:2.1.1.74)
Orthology
K04094  
methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
cow  Caldicellulosiruptor owensensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1963052..1964362)
Genome map
AA seq 436 aa AA seqDB search
MEVIVIGAGLAGVEAANAITKFGLKVKLFEMKPKKFSPAHKMETFAELVCSNSLKSKLLT
NASGLLKEEMKVFGSLVIEAARATSVEAGQALAVDRYKFSEYITQKIKQNELIEVIHEEV
TEVPKDKIVVICTGPLTTEGLLSDISKLCESKNLYFFDAAAPIVLKDSIDFSKAFFASRY
NKGSNDYINCPMTKEEYERFYWELVNAEVIEVKDFEKDLLFEGCMPIEEMARRGIDTMRF
GPLKPVGIIDPKTGKMPYAVVQLRKDTQDGKLYNMVGFQTRLKWGEQKRVFRLIPGLENA
EFVRYGVMHKNSYINSPEVLTKYLFLKKYPNIFFAGQITGVEGYLESASTGIIAGINAAR
QVLGKEPVSLPPNTCIGALIEYITTPKKDFQPMNANYGIISIDDEIAKIKDKEKRKLLIA
QKSLDICKEVANKIFE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggaagttatagttattggagctggacttgcaggagttgaagctgcaaatgcaataaca
aaatttggattaaaagtaaagctctttgagatgaaacctaaaaagttttcgccggcgcat
aagatggagacatttgcagagcttgtttgcagcaattctttaaagtctaagcttttaaca
aatgcttctgggcttttaaaagaggaaatgaaagtgtttggttcgcttgtgattgaagct
gcccgggcaacatcagttgaagcagggcaggctttggcagttgacaggtataagttttcg
gagtatataacccagaagataaagcaaaatgaacttattgaagttattcatgaggaagta
acagaagttccaaaagacaagatagtagtgatatgcactggaccacttacaacagaagga
cttctttctgatatttccaagctttgtgaaagcaaaaacctttatttttttgacgctgca
gcgccaattgtgctcaaagactctatagacttttcaaaagcgttttttgcctcgcgctac
aacaaaggttcaaatgactatataaactgcccaatgacaaaagaagaatatgaaagattt
tactgggaacttgtaaatgccgaagttattgaagtaaaagactttgagaaagacctgctg
tttgaaggttgcatgcccattgaagagatggcaagacgtggtattgacacaatgaggttt
ggtccactaaaaccagtaggaattattgatcctaagactggcaagatgccgtacgctgtt
gtacagcttagaaaagacacgcaggatggaaagctttataacatggtagggtttcagaca
agactcaaatggggtgaacaaaaaagggttttcaggctcattcccggccttgagaatgct
gagtttgtaagatatggtgtgatgcacaaaaattcttatattaactcacccgaagtgcta
accaagtacctttttcttaaaaaatatccaaacatattcttcgctgggcaaattacaggt
gttgaagggtatttggagtctgcatcaactggtatcattgcagggattaatgcagcaagg
caggttttaggaaaagagcctgtgagtttaccaccaaacacttgtattggtgctttgata
gagtatataacaacacccaaaaaagattttcagcctatgaacgcaaactatggtataata
tcaattgatgatgaaatagcaaagataaaagacaaggaaaagagaaaacttttgattgca
caaaaatcattggacatttgcaaagaagtagccaacaaaatttttgaataa

DBGET integrated database retrieval system