KEGG   Caldicellulosiruptor owensensis: Calow_2156Help
Entry
Calow_2156        CDS       T01347                                 

Definition
class ii aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Calow_2156
Enzymes [BR:cow01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Calow_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2307027..2307668
Genome map
AA seq 213 aa AA seqDB search
MQDIQTIKSQICRIGRIMYERGYISGPDGNISVRVDKDKIITTPSGVSKGFLHEDMLVLI
DMEGKILEKTNYKPSSEIKMHLKVYQEREDIGACVHAHSPYATTFAVLRKPLDKPILAES
VFIFGGYIPVAPFATPSTVEVPESIAPFIKDYDAVLLSNHGVLTYDKDLEMAFYKLEIVE
FWAKILFMSNQIGTPQVLSPEEIQKVLDLRKDK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatatacagaccatcaaatcccagatatgcaggattggaagaattatgtatgaa
agaggttatataagcggacctgatggaaacatctctgtaagagtcgacaaggataaaatc
attacaacaccgtcgggtgtgtcgaaaggttttttgcatgaagacatgctggttttaatt
gacatggaaggtaaaattcttgaaaagacaaattacaagccatcgtctgaaataaagatg
cacctcaaagtttatcaagaaagagaagacataggcgcctgtgttcatgcacattcacct
tatgcaacaacatttgcagtcttaagaaagcctcttgacaagccaattttagcagagtca
gttttcatctttggcgggtatatccctgttgcgccgtttgcaacaccttcaacagttgag
gtgccagagtcaatagcaccttttataaaagactatgatgctgtgcttctttcaaatcat
ggtgttttgacatacgataaggacttggagatggcattttacaaactcgagattgttgag
ttctgggcaaagattttatttatgtcaaaccagataggcacaccgcaagttttgagccct
gaggaaattcaaaaggttttggatttgagaaaggataagtaa

DBGET integrated database retrieval system