KEGG   Caldicellulosiruptor owensensis: Calow_2255Help
Entry
Calow_2255        CDS       T01347                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cow00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:cow02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2414981..2416624
Genome map
AA seq 547 aa AA seqDB search
MKRFFMKRKNLIVSTVLILCLILSTFALAQQESEENPHKVKNVILMIPDGMTIAHTSLAR
WYQDGESLAMDEIACGLIRTHSANNPITDSAPAATAYATGFKTQNRYLSIYPEMVSMPGV
GQVDEKDFYKPIVTILEAAKKAGKSTGLVFTCQFPHATPAAFASHSDNRNDYENIAEQMV
YNQVDVVFGGGYKYIDKNQRKDKEDLARYLKENGFFVTPSWYEAKNFYGQKIWGLFAQDA
MHYDFDRNGSGEPSLAEMTQKAIQLLSKNKNGFFLMVEGSEIDWASHANDPVGVISDVLA
FDRAVKVALEFAKSRNDTAVIIASDHSNGGMSIGNYSTKYDTAMLNDFLKYIKKAKRTGA
GIEELLGNNRTDENIKKIVSEYYGVDNLTQDEINAIKNAKTGELNYVLGPIISKRSNLGW
TTNGHTGEDVVLYAYHPNNYIPRGLIDNTEVCDYMAEILGIDLGSFNENAYISNIDLEEK
GYNVSIDTSNPSNVQLVISKENKTYIIPQNKNVVLAGSTQYRLKYVSVYIPTAKRFFVSS
EVENLIK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattttttatgaaaagaaaaaacttgattgtttctactgttttgattctgtgc
ttgatcctgtcaacatttgcactggcacagcaagaaagtgaagagaatcctcacaaagta
aaaaacgtaattttaatgattccagacggtatgacaatagctcatacaagccttgcacgc
tggtaccaggatggagaatctcttgcaatggatgaaattgcatgcggactgataagaaca
cattcagcaaacaatccaattacagactcagcaccagccgcaacagcatatgcaacaggg
tttaaaacccaaaacagatacctttcaatatatcctgaaatggtttcaatgccaggtgta
ggtcaggttgatgaaaaagatttttacaaaccaattgtaactatcttagaagctgctaag
aaggcaggaaaatcaactggtcttgtttttacatgccagtttcctcacgcaacacctgct
gcgtttgcatcacattcagataatagaaatgactatgagaatatagccgagcagatggtt
tacaatcaggttgatgtggtgtttggcggtggttataaatacattgacaaaaatcagaga
aaagacaaagaagatttagcaagatacctgaaagaaaatggtttttttgtaacaccaagc
tggtatgaagcaaaaaacttttatggacaaaaaatatggggtctttttgcacaggatgca
atgcactatgattttgatagaaacggttcaggtgagccgtctttggctgaaatgactcaa
aaagctattcagcttctttctaaaaacaaaaatggatttttcttgatggtggaaggcagt
gaaattgactgggcatcacacgcaaacgaccctgttggagtcatttcagatgttcttgca
tttgacagggctgtgaaagttgcacttgaatttgcaaaatcaagaaatgatacagcagtg
ataattgcatctgatcatagcaatggtggtatgagcataggcaattactcaacaaagtat
gatacagcaatgctcaatgattttttgaaatatatcaaaaaagcaaaaagaacgggagcc
gggatagaagaacttctgggtaataacagaacagatgagaatatcaaaaaaattgtttca
gaatattatggtgttgataatcttacacaggacgaaataaatgctattaaaaatgcaaag
acaggagaactcaattatgtgctcggaccaattatcagcaaaaggtcaaacctcggctgg
acaacaaatggtcatacaggcgaagatgtggtattatatgcatatcatccaaacaactat
ataccaagaggactaattgacaatacagaggtttgtgattatatggcagaaatccttggt
attgatcttggaagctttaatgaaaatgcttatatctcaaacattgacttggaggaaaaa
ggctataacgtctcaattgatacaagcaacccttcaaatgttcagcttgtaataagtaaa
gaaaacaaaacatatattattccacaaaataaaaatgtggtattagcaggttctactcag
tacaggctaaaatacgtaagcgtgtatattccaacagctaaaaggttttttgtatcaagc
gaggttgaaaatttgatcaaataa

DBGET integrated database retrieval system