KEGG   Caldicellulosiruptor owensensis: Calow_2255Help
Entry
Calow_2255        CDS       T01347                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Calow_2255
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Calow_2255
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Calow_2255
Enzymes [BR:cow01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Calow_2255
Exosome [BR:cow04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calow_2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2414981..2416624
Genome map
AA seq 547 aa AA seqDB search
MKRFFMKRKNLIVSTVLILCLILSTFALAQQESEENPHKVKNVILMIPDGMTIAHTSLAR
WYQDGESLAMDEIACGLIRTHSANNPITDSAPAATAYATGFKTQNRYLSIYPEMVSMPGV
GQVDEKDFYKPIVTILEAAKKAGKSTGLVFTCQFPHATPAAFASHSDNRNDYENIAEQMV
YNQVDVVFGGGYKYIDKNQRKDKEDLARYLKENGFFVTPSWYEAKNFYGQKIWGLFAQDA
MHYDFDRNGSGEPSLAEMTQKAIQLLSKNKNGFFLMVEGSEIDWASHANDPVGVISDVLA
FDRAVKVALEFAKSRNDTAVIIASDHSNGGMSIGNYSTKYDTAMLNDFLKYIKKAKRTGA
GIEELLGNNRTDENIKKIVSEYYGVDNLTQDEINAIKNAKTGELNYVLGPIISKRSNLGW
TTNGHTGEDVVLYAYHPNNYIPRGLIDNTEVCDYMAEILGIDLGSFNENAYISNIDLEEK
GYNVSIDTSNPSNVQLVISKENKTYIIPQNKNVVLAGSTQYRLKYVSVYIPTAKRFFVSS
EVENLIK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattttttatgaaaagaaaaaacttgattgtttctactgttttgattctgtgc
ttgatcctgtcaacatttgcactggcacagcaagaaagtgaagagaatcctcacaaagta
aaaaacgtaattttaatgattccagacggtatgacaatagctcatacaagccttgcacgc
tggtaccaggatggagaatctcttgcaatggatgaaattgcatgcggactgataagaaca
cattcagcaaacaatccaattacagactcagcaccagccgcaacagcatatgcaacaggg
tttaaaacccaaaacagatacctttcaatatatcctgaaatggtttcaatgccaggtgta
ggtcaggttgatgaaaaagatttttacaaaccaattgtaactatcttagaagctgctaag
aaggcaggaaaatcaactggtcttgtttttacatgccagtttcctcacgcaacacctgct
gcgtttgcatcacattcagataatagaaatgactatgagaatatagccgagcagatggtt
tacaatcaggttgatgtggtgtttggcggtggttataaatacattgacaaaaatcagaga
aaagacaaagaagatttagcaagatacctgaaagaaaatggtttttttgtaacaccaagc
tggtatgaagcaaaaaacttttatggacaaaaaatatggggtctttttgcacaggatgca
atgcactatgattttgatagaaacggttcaggtgagccgtctttggctgaaatgactcaa
aaagctattcagcttctttctaaaaacaaaaatggatttttcttgatggtggaaggcagt
gaaattgactgggcatcacacgcaaacgaccctgttggagtcatttcagatgttcttgca
tttgacagggctgtgaaagttgcacttgaatttgcaaaatcaagaaatgatacagcagtg
ataattgcatctgatcatagcaatggtggtatgagcataggcaattactcaacaaagtat
gatacagcaatgctcaatgattttttgaaatatatcaaaaaagcaaaaagaacgggagcc
gggatagaagaacttctgggtaataacagaacagatgagaatatcaaaaaaattgtttca
gaatattatggtgttgataatcttacacaggacgaaataaatgctattaaaaatgcaaag
acaggagaactcaattatgtgctcggaccaattatcagcaaaaggtcaaacctcggctgg
acaacaaatggtcatacaggcgaagatgtggtattatatgcatatcatccaaacaactat
ataccaagaggactaattgacaatacagaggtttgtgattatatggcagaaatccttggt
attgatcttggaagctttaatgaaaatgcttatatctcaaacattgacttggaggaaaaa
ggctataacgtctcaattgatacaagcaacccttcaaatgttcagcttgtaataagtaaa
gaaaacaaaacatatattattccacaaaataaaaatgtggtattagcaggttctactcag
tacaggctaaaatacgtaagcgtgtatattccaacagctaaaaggttttttgtatcaagc
gaggttgaaaatttgatcaaataa

DBGET integrated database retrieval system