KEGG   Chlamydia pneumoniae AR39: CP0127Help
Entry
CP0127            CDS       T00029                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
127446..128069
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGTLTYVHTGAIVIECQGIGYHIAITERWAIECIRALHQDFLVFTHVIFRETEHL
LYGFHSREERECFRILISFSGIGPKLALAILNALPLKVLCSVVRSEDIRALASVSGIGKK
TAEKLMVELKQKLPDLLPLDSRVETSQTHTTSSCLEEGIQALAALGYSKIAAERMIAEAI
KDLPEGSSLTDILPIALKKNFSGVNKD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggaacactgacctatgtgcatactggtgcaattgttatagaa
tgccaaggtattggctaccatattgctattacagaacgttgggcaatagaatgcatcagg
gctttacatcaagactttctcgtcttcactcatgtgatattccgtgaaacggaacacttg
ctctatgggtttcattctcgagaagagcgagagtgtttccgtattttaatttctttttct
ggaataggacctaagctagccctcgcgattcttaatgcgctacctttaaaggtactatgt
tctgtagtccgatctgaagatattcgtgctttagcttccgtatcgggaattgggaaaaaa
actgctgaaaaactcatggttgagcttaaacaaaaattaccagatttacttcctctagac
tcgagagtggagaccagccaaacacataccacctcttcttgcttggaggaaggcattcag
gctttagcagctttgggttattcaaaaattgctgctgaacgtatgattgccgaagcaatc
aaagatctccctgagggatcttctttaacagatatccttcctatcgctctgaaaaagaat
ttttcaggagtgaacaaggactag

DBGET integrated database retrieval system