KEGG   Chlamydia pneumoniae AR39: CP0127Help
Entry
CP0127            CDS       T00029                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CP0127 (ruvA)
Enzymes [BR:cpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CP0127 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
127446..128069
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGTLTYVHTGAIVIECQGIGYHIAITERWAIECIRALHQDFLVFTHVIFRETEHL
LYGFHSREERECFRILISFSGIGPKLALAILNALPLKVLCSVVRSEDIRALASVSGIGKK
TAEKLMVELKQKLPDLLPLDSRVETSQTHTTSSCLEEGIQALAALGYSKIAAERMIAEAI
KDLPEGSSLTDILPIALKKNFSGVNKD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggaacactgacctatgtgcatactggtgcaattgttatagaa
tgccaaggtattggctaccatattgctattacagaacgttgggcaatagaatgcatcagg
gctttacatcaagactttctcgtcttcactcatgtgatattccgtgaaacggaacacttg
ctctatgggtttcattctcgagaagagcgagagtgtttccgtattttaatttctttttct
ggaataggacctaagctagccctcgcgattcttaatgcgctacctttaaaggtactatgt
tctgtagtccgatctgaagatattcgtgctttagcttccgtatcgggaattgggaaaaaa
actgctgaaaaactcatggttgagcttaaacaaaaattaccagatttacttcctctagac
tcgagagtggagaccagccaaacacataccacctcttcttgcttggaggaaggcattcag
gctttagcagctttgggttattcaaaaattgctgctgaacgtatgattgccgaagcaatc
aaagatctccctgagggatcttctttaacagatatccttcctatcgctctgaaaaagaat
ttttcaggagtgaacaaggactag

DBGET integrated database retrieval system