KEGG   Chlamydia pneumoniae AR39: CP0178Help
Entry
CP0178            CDS       T00029                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpa00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cpa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
179463..180839
Genome map
AA seq 458 aa AA seqDB search
MQIAQVFGCGRLNGEVKVSGAKNAATKLLVASLLSDQKCTLRNVPDIGDVSLTVELCKSL
GAHVSWDKETEVLEIYTPEIQCTRVPPTFSNVNRIPILLLGALLGRCPEGVYVPTVGGDA
IGERTLNFHFEGLKQLGVQISSDSSGYYAKAPRGLKGNYIHLPYPSVGATENLILAAIHA
KGRTVIKNVALEAEILDLVLFLQKAGADITTDNDRTIDIFGTGGLGSVDHTILPDKIEAA
SFGMAAVVSGGRVFVRNAKQELLIPFLKMLRSIGGGFLVSESGIEFFQERPLVGGVVLET
DVHPGFLTDWQQPFAVLLSQAQGSSVIHETVHENRLGYLHGLQHMGAECQLFHQCLSTKA
CRYAIGNFPHSAVIHGATPLWASHLVIPDLRAGFAYVMAALIAEGGGSIIENTHLLDRGY
TNWVGKLRSLGAKIQIFDMEQEELTTSPKSLALRDASL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgctcaagtatttggttgtggtagacttaatggtgaggtaaaagtttcagga
gcaaaaaatgctgcaactaagctgcttgttgcttctttactttctgatcagaagtgcaca
ctgcggaatgtccccgatataggagatgtttccttaactgtagagttatgcaagtcgcta
ggagcacatgtttcttgggataaggaaacagaggttttggaaatctatactcccgaaata
caatgcacaagagttcctcccacattttcaaatgtcaataggatccccatccttttatta
ggagcgctgttagggcgttgccctgaaggtgtctatgttcccactgtggggggagatgct
ataggagaaaggaccttaaactttcattttgaagggttaaaacaacttggtgtgcagatt
tcctctgatagttcgggatactacgcaaaggctcctcgaggtcttaaagggaattatatt
catctaccctatccttctgtaggggctacagaaaatctcatactcgcagcaattcatgct
aaaggaagaacggttataaaaaatgtagctctcgaagctgaaatcttagatttggtgctc
tttttgcaaaaggcaggggcggatatcactaccgataatgatcgtacgatagatattttt
ggcactggaggtctcggctctgtagaccacaccatccttccagataagattgaagcagcc
tcttttggaatggccgcggttgtctctggaggacgtgttttcgtccgaaatgctaaacaa
gaacttctgattcccttcctcaagatgttgcgctccataggcggaggatttttggtctcc
gagtcgggaatagaattttttcaagaacgccccttggtgggaggtgttgtcttggaaacc
gatgttcatccagggttcctgacggactggcaacaacccttcgcagttctactatcacag
gctcagggatcttcagtaatccatgagactgtccatgaaaatcgcctcggctaccttcat
ggtcttcagcacatgggagctgagtgtcagctttttcatcagtgcttaagtaccaaggca
tgtcgttatgctatcgggaattttcctcacagcgctgtgattcatggggcgacgccttta
tgggcctcgcatttagtcattccagatttacgagcaggatttgcctatgtcatggcagca
ctgattgcagaaggaggaggctctattattgagaacactcatcttctagatcgtggatat
acaaattgggtaggcaagctcagaagcctcggagctaaaattcagatctttgatatggaa
caggaagaacttacaacctctccaaagtctttagccctaagagatgcatccctgtag

DBGET integrated database retrieval system