KEGG   Chlamydia pneumoniae AR39: CP0225Help
Entry
CP0225            CDS       T00029                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CP0225
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CP0225
  Amino acid metabolism
   00310 Lysine degradation
    CP0225
Enzymes [BR:cpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CP0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231681..232862
Genome map
AA seq 393 aa AA seqDB search
MIFEFRFPKIGETSSGGSIVRWLKNLGDHVARDEPLIEVSTDKIATELPSPKAGRLVRFC
VNEGDEVASGDVLGLIELEEISEADDESTSCPLTSCETKSEAGSSSSSVWFSPAVLSLAQ
REGIGLDNLQKIAGTGKGGRVTRQDLEAYISESQQVSIPEIFQGEVNRIPMSPLRRAIAS
SLSKSSDEVPHASLVVDVDVTDLMNLISGERQRFLDTHGVKLTITSFIVQCLAQTLRQFP
LLNGSLDGTTIVMKKSVNVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKALADLSSRARLN
KLDPSEVQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMV
YVTLTFDHRVLDGIYGSEFLTSLKNRLESVTMG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgagttccgattccctaaaataggagagacgagttccggaggatctatagtc
cgttggttaaaaaatttgggtgatcatgtagctagagatgagcctctgattgaagtatct
acggataaaattgctacagaattaccctctcctaaagcaggccgactggtgcgtttctgc
gtcaatgagggagacgaggttgcttctggggatgttttaggattgatagagcttgaggag
atttccgaagctgatgatgagagcacctcatgtcctctgacttcttgtgaaacaaagtcg
gaggcgggttccagcagttcttcggtatggttttctcctgccgtgctgagtttagctcaa
cgtgaaggcattggtcttgataacctccaaaagattgccggcacggggaaagggggacga
gtgactcgtcaggatttagaagcgtatatttcagaatcgcaacaagtttctattcccgaa
atatttcaaggagaagtgaatcgcattcctatgtctccgctacgtcgggcaatagcttct
tctctctccaagtcttcagatgaggttcctcacgcatctttggttgttgatgtcgatgtc
acagatcttatgaatctgatttctggtgaacgccaacgcttcttagatacgcatggggtg
aagctaacgattacaagtttcattgtacagtgtttagctcagactttaaggcagtttcct
ttattgaatggttccttagatgggactaccattgttatgaagaaatctgtgaatgtaggc
gttgccgtgaacctcaataaggaaggggttgttgttcctgtcatccacaattgtcaagat
cgcggtttagtaagtattgcaaaggccttggcggatctatcttcaagggctcggttaaat
aaattggatcctagtgaagtgcaagatggcagcgttactgtcacgaattttggaatgacg
ggagctttgattgggatgcccatcatacgttatcctgaagttgctattttaggaattggc
acaatacaaaaacgtgttgtcgtccgtgatgacgattctttagccattcgcaaaatggtc
tatgtgacacttacctttgaccatagagtattggatggtatttacggcagtgagttttta
acctcattgaaaaatcgtttggagtctgttacgatgggctaa

DBGET integrated database retrieval system