KEGG   Chlamydia pneumoniae AR39: CP0231Help
Entry
CP0231            CDS       T00029                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(236927..237598)
Genome map
AA seq 223 aa AA seqDB search
MTLYLGLNQKTARKYQAHYLPILTLFPYAKSTPQNKRALQFLPQATHVILTSPSSTHLFL
SRMTSLLSKATLKTKTYLCIGESTKERLLSFLGQVKYVVATQEIAEGIFPLLQALPSSAR
ILYPHSSLARPVIREFLYNRFTFFSYPHYTVKPRKLKKNILSKYKKIIFTSPSTVRAFAK
IFPRFPEKTYWCQGRMTLQEFQKFSSQKQVSLLETLGKSRTSP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaccctctacttaggattgaatcaaaaaaccgctcgtaaataccaagctcattatttg
cctattctaactctcttcccctatgcaaaaagcactccacaaaataagcgtgctcttcaa
ttccttccacaagcaacccatgtgattctcacaagtccctcatccactcacctattcctt
tccagaatgacttctcttctttctaaggccactctaaaaacaaagacctacctctgtata
ggagagtccaccaaagaaagacttctctctttccttggacaagtgaagtacgtagtagca
actcaagaaatcgctgaaggcatcttcccattgctacaggcactgccctcttcagcccgc
attctctacccccactcctccctcgcaagacctgtgatcagagaatttctttacaatcga
tttacttttttctcttaccctcactacacagtgaagccgcgaaaacttaaaaaaaatatt
ttatctaaatacaaaaaaattatcttcacaagcccttcaactgtaagagctttcgccaaa
atctttccgcgatttcctgaaaaaacctactggtgccaaggaaggatgaccttgcaggag
tttcaaaagttctcctctcaaaagcaggtatctttgttagaaacgcttgggaagtccagg
acatctccgtga

DBGET integrated database retrieval system