KEGG   Chlamydia pneumoniae AR39: CP0336Help
Entry
CP0336            CDS       T00029                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cpa00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cpa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
376796..378247
Genome map
AA seq 483 aa AA seqDB search
MDLKELLHGVQAKIYGKVRPLEVRNLTRDSRCVSVGDIFIAHKGQRYDGNDFAVDALANG
AIAIASSLYNPFLSVVQIITPNLEELEAELSAKYYEYPSSKLHTIGVTGTNGKTTVTCLI
KALLDSYQKPSGLLGTIEHILGEGVIKDGFTTPTPALLQKYLATMVRQNRDAVVMEVSSI
GLASGRVAYTNFDTAVLTNITLDHLDFHGTFETYVAAKAKLFSLVPPSGMVVINTDSPYA
SQCIESAKAPVITYGIESAADYRATDIQLSSSGTKYTLVYGDQKIACSSSFIGKYNVYNL
LAAISTVHASLRCDLEDLLEKIGLCQPPPGRLDPVLMGPCPVYIDYAHTPDALDNVLTGL
HELLPEGGRLIVVFGCGGDRDRSKRKLMAQVVERYGFAVVTSDNPRSEPPEDIVNEICDG
FYSKNYFIEIDRKQAITYALSIASDRDIVLIAGKGHEAYQIFKHQTVAFDDKQTVCEVLA
SYV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaagagttactccatggggttcaagctaaaatctacgggaaagttcgccct
cttgaagtgcgcaacttgacacgtgattcccgttgtgtgagtgttggcgacatttttata
gcccataagggacagcgctacgacggaaatgattttgctgtcgatgctttagctaatgga
gcaattgccattgcttcttcactatacaatccgtttctttccgttgttcagatcatcact
cctaatctcgaagaattagaggctgagctttctgcaaagtattacgaatacccttcaagt
aagctccataccattggggtgactggaaccaatgggaaaactacagttacatgtttgatt
aaagctttattggatagctatcaaaaaccttcagggcttttaggaaccatagagcatatc
ttaggagagggggtgattaaagatgggtttactacacctacacccgctcttttacagaag
tatttagccactatggtacgtcaaaatagagacgctgttgttatggaagtctcttctata
ggacttgcctctggaagagtagcctataccaattttgatacagcagttctgactaatatt
accttagatcatctcgattttcatggcacatttgaaacctatgttgcggcgaaagccaag
cttttctctctcgtgcccccttcgggaatggttgttatcaacacagactctccctacgct
tctcagtgtattgagagtgcaaaggcaccggtcatcacttatggtatagagagtgctgct
gactaccgagccaccgatatccaactttcttcctcgggaacaaagtataccttggtgtac
ggggaccaaaaaattgcgtgctcttcctcatttattggaaagtacaacgtctataaccta
cttgctgcgatctctacagtacatgcaagtttgcgttgcgatcttgaagatttgctagaa
aagataggcttgtgtcaacctcctccaggtcgtttggatcctgtacttatgggtccctgc
cctgtatatattgattatgcacacacccccgatgctttagacaatgtcttaacaggattg
catgagttacttcctgaggggggaagactgattgttgtttttggttgcggtggagataga
gatcgcagtaaacggaagttgatggcccaggtggtagagcgttatggttttgctgttgta
acttcagataaccctaggagcgagcctcctgaagatattgtgaatgaaatttgtgatggg
ttttattcaaaaaactatttcatcgaaatcgacagaaaacaagcaattacatatgctctg
tctattgcctcagatagagatatagtgttaatagcgggaaaagggcatgaagcttaccaa
atatttaaacaccaaacagttgcgttcgatgataagcagactgtttgtgaggtactcgct
tcctatgtctaa

DBGET integrated database retrieval system