KEGG   Chlamydia pneumoniae AR39: CP0379Help
Entry
CP0379            CDS       T00029                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CP0379
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CP0379
  Amino acid metabolism
   00310 Lysine degradation
    CP0379
Enzymes [BR:cpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CP0379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
417759..418853
Genome map
AA seq 364 aa AA seqDB search
MTTEVRIPNIAESISEVTVASLLVTEGALIQENQGLLEIESDKVNQLIYAPVSGRIFWEV
SEGDVVPVGGVVGKIEPAGEGEELGDSQSKETIEAEIICFPQSGVRQSPPENKTFIPLRD
QMDQGSQGLSAGDRGETRERMTSIRKTISRRLLSALHESAMLTTFNEVYMTPLFHLRKEK
QEEFLSRYGVKLGFMSFFVKAVLEALKAYPRVNAYIDGEEIVYRHYYDISIAVGIDRGLV
VPVIRDCDKLSNGEIEQKLADLALRAREGLLAIAELEGGGFTITNGGVYGSLLSTPIINP
PQVGILGMHKIEKRPVVLDNEIVIADMMYVALSYDHRLIDGKEAVGFLVKVKEGLENPAS
LLDL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgactacagaagtacgcattcctaatattgcagagtcgattagcgaggtgaccgtagct
tccttgttagttacagagggtgctctgattcaagaaaaccagggcttactagaaattgaa
agtgataaggtaaatcagctcatttatgccccagtatcgggaagaattttctgggaggtt
tcagaaggcgatgttgttcctgtagggggggtagtgggaaaaatagagcccgcaggtgaa
ggggaagagcttggagattctcagtctaaagagactatagaagctgagatcatttgcttt
cctcagtctggggtgcgtcagtctcctccagagaataaaacgtttattcctcttcgtgat
cagatggaccaaggatcccaaggtctttctgcaggagatcgaggagaaactcgagaacgc
atgacctcgattcgtaagacaatttcgcggcgtcttttgtctgctttacatgagtctgcg
atgctcacgacattcaatgaggtctatatgacacctctttttcatttgcgaaaggaaaaa
caagaagagtttctatctcgatatggggtgaagttaggatttatgtctttctttgtgaaa
gctgtcttagaggctttgaaggcatatccacgagtgaacgcctatattgatggcgaggag
attgtttaccgtcactattatgacatttctattgctgtaggtatcgatcgaggacttgtg
gttcctgtgatacgcgattgcgataaactttctaacggggagattgagcagaaactcgca
gatcttgcccttcgggctcgtgaaggcctacttgcaatagcggagcttgagggaggaggt
ttcacaattaccaatggaggcgtatatggatcgctactttcgactcccattatcaatccc
ccgcaagtggggattttggggatgcataagatagaaaagcgccccgttgttcttgataat
gaaattgtaattgcagatatgatgtatgtcgctttaagctatgatcatcgtcttattgat
gggaaagaggctgttgggtttttagtcaaagtgaaagaaggcctagagaatcctgcctca
ttactcgacttgtaa

DBGET integrated database retrieval system