KEGG   Chlamydia pneumoniae AR39: CP0431Help
Entry
CP0431            CDS       T00029                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CP0431
Enzymes [BR:cpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CP0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(468555..470135)
Genome map
AA seq 526 aa AA seqDB search
MNVLKYTKHSPSAHAWKLIGTSPKHGIYLPLFSIHTKNSCGIGEFLDLIPLISWCQKQGF
SVIQLLPLNDTGEDTSPYNSISSVALNPLFLSLSSLPNIDTIPEVAKKLQDMHELCSTPS
VSYTQVKEKKWAFLREYYQKCCKSSLEGNSNFSEFLESERYWLYPYGTFRAIKHHMHGEP
INNWPKSLTDQENFPDLTKKFHDEVLFFSYLQFLCYQQLCEVKAYADQHHVLLKGDLPIL
ISKDSCDVWYFRDYFSSSRSVGAPPDLYNSEGQNWHLPIYNFSQLAKDDYIWWKERLRYA
QNFYSVYRLDHIIGFFRLWIWDSSGRGRFIPDNPKDYIKQGTEILSTMLGASSMLPIGED
LGIIPQDVKTTLTHLGICGTRIPRWERNWESDSAFIPLKDYNPLSVTTLSTHDSDTFAQW
WLNSPKEAKQFAKFLHLPFQKTLTTETQIDILKLSHESASIFHINLFNDYLALCPDLVSK
NLQRERINTPGTISKKNWSYRVRPSLEELAIHKKFNGYIEKILTGL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgttttaaaatacacaaaacactcaccctcagcacatgcttggaaacttatagga
acctctcctaaacacgggatttatctcccactattttcaatacacacaaaaaatagctgt
ggaatcggtgaatttttagatctcattcctctgatctcttggtgccaaaaacagggcttc
agcgttattcagcttctccctttaaatgatactggtgaagatacgagtccctataacagc
atctcttccgtagccctgaatcccctattcctttccctatcctctcttccaaatatcgat
accatccctgaagttgccaagaaacttcaagatatgcatgagttatgctcgactccatca
gtcagctatactcaagttaaagaaaaaaaatgggcattcttaagagagtactaccaaaaa
tgttgcaagtcttccctcgaaggaaactcaaatttttctgagtttctagaaagcgagcgc
tattggctttatccctatgggacctttcgtgcaatcaaacatcatatgcacggagaacct
attaataactggccgaagtcgctcacagatcaggagaattttccggacttaactaaaaaa
ttccatgatgaagtcctctttttttcctatctacagtttctctgttaccaacagctctgc
gaagtgaaagcctatgcagatcaacaccacgtcctgcttaaaggagacctccctattctt
attagcaaggatagctgtgatgtttggtatttccgagactacttttcttcatcaaggtct
gtaggagctcctcctgacctctacaattctgaaggacaaaactggcatctgcctatttat
aatttttcacaacttgccaaagacgactacatttggtggaaagagcgtctgcgatatgct
caaaacttctattccgtctatcgcttagatcatattataggatttttccgtttgtggatt
tgggattcttcaggaagaggaaggttcattccagacaatcctaaagactatataaagcag
ggcacggagatcctttctactatgctcggagcctcttctatgttacctatcggagaagat
ttagggattataccccaagacgtcaaaacgacattaacacacttaggaatctgtggaacc
cggattccacgatgggaacgcaactgggaaagcgacagtgccttcattcccctaaaagat
tataatccactttctgtgaccactctctctacccacgactctgatacgtttgcccaatgg
tggctcaattcacctaaggaagctaagcaatttgctaaatttctacatcttccttttcaa
aaaaccctgactacagaaactcaaatagacatcttaaaactttctcatgaatcagcatct
atctttcatatcaacctctttaacgattatctcgccctctgccctgatttagtatcaaaa
aatctacaaagagaacgcattaatacacctgggacaatttctaaaaagaattggtcgtat
cgagttcggccttccttagaagaactcgctattcataaaaaatttaatggttacattgag
aagatccttacaggactgtaa

DBGET integrated database retrieval system