KEGG   Chlamydia pneumoniae AR39: CP0559Help
Entry
CP0559            CDS       T00029                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CP0559
   01230 Biosynthesis of amino acids
    CP0559
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CP0559
   00030 Pentose phosphate pathway
    CP0559
   00051 Fructose and mannose metabolism
    CP0559
   00052 Galactose metabolism
    CP0559
  Energy metabolism
   00680 Methane metabolism
    CP0559
Enzymes [BR:cpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CP0559
Protein phosphatases and associated proteins [BR:cpa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CP0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(590684..592336)
Genome map
AA seq 550 aa AA seqDB search
MHPLYVDLDTIISSYSPPLPKEFQEAASLIAVPDTSHSKPVVPGVKTLFPQTYHLPYLKF
VQGENVVHTPLKVGVMFSGGPAPGGHNVIQGLFNSLKDFHPDSSLVGFVNNGDGLTNNKS
IDITEEFLSKFRNSGGFNCIGTGRKKIVTPEAKEACLKTAEALDLDGLVIIGGDGSNTAT
AILAEYFAKRRPKTSIVGVPKTIDGDLQHTFLDLTFGFDTATKFYSSIISNISRDALSCK
AHYHFIKLMGRSASHIALECALQTHPNIALIGEEIAEKNLPLKTIIHKICSVIADRAAME
KYYGVILIPEGIIEFIPEIINLITEIESLSEYEDKISRLSPESQRLLKSFPAPIIEQILN
DRDAHGNVYVSKISVDKLLIHLVSNHLQQYFPNVPFNAISHFLGYEGRSGLPTKFDNTYG
YSLGYGAGILVRNHCNGYLSTIESLACPFMKWKLRAIPVVKMFTVKQQADGTLQPKIKKY
LVDIGSTAFRKFKLYRKIWALEDSYRFLGPLQIETPPEMHSDNFPPLTLLLNHNFWQRHQ
GCIEIPDTTY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctttatacgttgatcttgatactattatcagctcctactctcctcccttacct
aaagaatttcaagaagcagcctctttaattgctgttccagatacttcacattctaagcct
gtcgttccaggagtgaaaaccctctttccacaaacctaccaccttccctatctaaagttt
gtccaaggagaaaatgtcgttcacactcctctaaaagtaggcgtaatgttctcaggagga
cctgctccaggaggacataatgtcatccaaggactcttcaatagtctaaaagatttccat
cccgattcctccctcgtggggttcgtaaataatggagacggtcttacaaacaataaaagc
atagacattactgaagagtttctctccaaattccgaaattccggaggcttcaactgtata
ggaacaggaaggaaaaaaattgtaactccagaagctaaagaggcttgtctaaagaccgca
gaggctctggatctcgacggactagtcattattggcggtgatggctccaatacagcaacc
gctattcttgcagagtattttgcaaaacgacgcccaaaaacctctattgtcggagttcct
aaaactatagatggggatctacaacacaccttcttggatctgaccttcggatttgatact
gcaacaaaattctactcttcaatcattagcaatatttcaagagatgctctttcctgtaaa
gctcattaccacttcattaaacttatgggacgctcagcatcccatattgctttggaatgt
gctctccaaactcatccaaatattgcccttatcggcgaagaaattgccgaaaaaaatcta
ccactaaaaaccatcatccataaaatctgctccgtaattgcagatagagccgctatggaa
aaatactatggcgtcatcctcatcccagaaggcattatcgagttcatcccagaaatcatc
aacttaattacagaaatcgaaagcctatcagaatacgaagataaaatctccaggctctct
ccagaatcccaacgcctactgaaaagcttcccagcacctatcatcgagcaaatcctcaat
gaccgcgatgctcacggtaatgtctatgtttctaaaattagtgtcgataaactactcatc
cacctggtcagcaatcatctccaacaatatttccctaacgtccctttcaatgcgatctca
cattttctaggatatgaaggacgctcgggattgcctacaaaattcgataatacctacggc
tatagcctcggatacggcgccggtattctcgtccgcaatcactgcaacggctatctctct
actatagaatccctagcatgccctttcatgaaatggaaattacgggcaattcccgtagtg
aaaatgttcacagtaaaacaacaggcagatggaactctacaacctaaaattaaaaaatac
ctcgtagatataggaagcacggcatttcgtaaatttaagctctataggaaaatttgggcc
ctcgaagactcctaccgattcctagggcctctacaaatagaaactcctccagaaatgcac
tctgataatttccctcctcttacccttttgcttaatcataacttttggcaacgtcaccag
ggttgcatagaaatccctgatactacgtattaa

DBGET integrated database retrieval system