KEGG   Chlamydia pneumoniae AR39: CP0650Help
Entry
CP0650            CDS       T00029                                 

Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CP0650
Enzymes [BR:cpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CP0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
685232..687430
Genome map
AA seq 732 aa AA seqDB search
MEKICGYLEQILVENKDSGDITAYIKIPNKTTPILIKGKLPQPLELGSPIQIYGVWSHSP
SNTKYFQIHSYDSPLLYEYRGVFHYLTSKLIKGIGPKIAEKIIEKFQEKTCYVLDITPER
LSEVSGISETRCVSICKQLCEQKILRKTLLFLQEYNIPIHYGVRIFKKYQEKSIEKICED
PFLLAREMEGIGFKTADFIAMKLGVPRNSESRLCAGIQHSLEELQEEGHTCYPIELLIDV
VAKLLNQDVFDTPITLEEIDTQILNMQKRKLLHIQDISGTLHVWTRYLHLAEKTIVSDLK
RILFSSRRIRSIDGEKAIAWVEENLSIDLAEQQREAIKACFSEKLLIITGGPGTGKSTIT
QAILKIFEQVTHKIILAAPTGKAAKRMTEITQKHSVTIHALLQYDFKTKSFRKNHDNPID
CDLIIVDESGMMDTHLLHHFLKALPDYTTLVFIGDIHQLPSVGPGNILKDLITSNKMTVI
RLNKIFRQVHDSGIVTNAHRVNEGELPILYSETGRRDFLFFQKDDQEEALNHIIHLVTKF
VPQKYHIYPQDIQVLAPMKKGTLGIYNLNKALKHALNPKKANLHGRFQSYAVGDKVMQIR
NNYNKEVFNGDIGYVSTINFEDKAVVVRMEGKHVGYSFSELDDLVLAYATSVHKYQGSES
PCIIIPIHTSHFMMLYRNLLYTAITRGKKLVILVGTKKAIAIATRNNRVQHRCTGLAEVL
KELDTKKNYADL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatctgcggatacttagagcaaatacttgttgaaaacaaagactctggggac
attactgcttatatcaaaatacccaataaaacgactcctatcctaattaaaggcaaactt
ccccaacctttggaactaggatccccgatccaaatctatggtgtctggagccattcccct
tcaaatactaagtatttccaaatccatagttacgactctcctcttctttatgaatatcgt
ggcgtattccattacctcacctcaaaactcatcaaaggaatcggccctaaaatcgcagaa
aagatcatcgagaaatttcaagagaaaacatgttatgtcctcgatatcactccagaacgc
ttaagtgaggtttctggaattagcgaaacacgatgtgtctctatttgcaaacaactctgc
gagcaaaaaatcttaaggaaaactcttctctttctccaagaatacaatatcccgattcat
tatggagtgagaatttttaaaaaataccaagagaaatccatagaaaaaatttgcgaagat
cccttccttctagccagagaaatggagggcatcggattcaaaactgctgatttcatagct
atgaaactaggcgtccccagaaattctgaaagtcgcctatgtgctggtatccagcactcc
ttagaagaacttcaagaagaaggtcatacttgctatccgatagagctcctgatagatgtc
gtcgccaaactattaaatcaagatgtctttgatactcctattactctcgaagaaatcgat
acgcaaatcctcaatatgcaaaagcgtaagcttttacatattcaagacatttctgggaca
ctccatgtctggacacgttatctccatctcgcagagaaaactattgtttctgatctcaag
cgcattttattttcttcgaggagaatccgttctatagacggagaaaaagcaattgcttgg
gtagaggaaaacctaagtatagatctcgcagaacaacaacgagaagcaattaaagcctgt
ttttctgaaaaacttctcatcattactgggggccctggaactggaaaaagtaccattacc
caagcaatactgaaaatttttgaacaggtgactcataaaatcatcctcgcagctcctaca
ggaaaagccgctaaacggatgaccgaaattacacaaaaacactccgtcaccattcatgct
ctgctacagtatgattttaaaacgaaatctttccgcaagaaccatgacaatcctatagac
tgtgatctgatcattgttgacgaatccggaatgatggacacgcacttgctgcaccacttc
ctgaaagcacttcctgactacacaactcttgtctttattggagacattcaccagctaccc
agcgtgggcccaggaaatatccttaaagacttgattacttcgaataaaatgacagtcatc
agattaaataagatcttccgccaagttcatgattcgggaatcgttacgaatgcccatagg
gtaaatgaaggggaactccccatattatattcagaaacagggcgtcgtgatttcttattt
ttccaaaaggatgatcaagaagaggctctcaatcatatcattcatcttgtgacaaaattc
gtcccacaaaaataccatatctatcctcaagatatccaagtactagctcccatgaaaaaa
ggaaccctaggaatctataatctaaataaagcactcaaacatgcattaaaccctaaaaaa
gcaaatcttcacggtagatttcaatcctatgccgttggcgataaggtaatgcaaatccgc
aacaactataataaagaagtctttaacggcgatataggctatgtctctacaatcaacttc
gaagataaagctgttgttgtccgtatggaaggaaagcatgtcggctattctttctcagag
cttgacgatctagtcttagcctatgctacctcagtacataagtaccagggaagtgaaagc
ccctgcattatcattcctattcatacctcgcactttatgatgctctatagaaatcttctc
tatactgctattacgcgggggaaaaaattggtgattctagttgggacaaaaaaagccatt
gctattgcaacaagaaataatcgagtgcaacaccgatgtacaggactagcagaagttctt
aaagagctcgatactaagaaaaattatgcagatctgtaa

DBGET integrated database retrieval system