KEGG   Chlamydia pneumoniae AR39: CP1098Help
Entry
CP1098            CDS       T00029                                 

Definition
hypothetical protein
Organism
cpa  Chlamydia pneumoniae AR39
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198015..1198248)
Genome map
AA seq 77 aa AA seqDB search
MNEGIHSVCFQKTPRLTAKSVVSMEMLLTTQQLPSAEGMPSVANLEADFLRAEALLAEMR
EIRGCLEQSLRTLVPSE
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaggtatccactctgtctgttttcaaaaaacacctcggcttactgcgaagtcc
gtagtgagtatggagatgctcttaactactcaacagcttccttccgcagaagggatgccc
tcggttgctaatttggaagcggattttttacgagcagaagctctgttagcagaaatgcga
gaaattcgtggttgcttggagcaatctttgcgaacactagtccctagtgagtag

DBGET integrated database retrieval system