KEGG   Chlamydia pneumoniae AR39: CP1120Help
Entry
CP1120            CDS       T00029                                 

Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpa  Chlamydia pneumoniae AR39
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1221358..1222839)
Genome map
AA seq 493 aa AA seqDB search
MHTEFAPFLEDLVHQQVISPLDIAFASKHISSDFEESFVFLAVSSALWRYGHPFLSLEEN
RIRPSLGGISETDLYRGFHNLPKEVRDKLFVVVSGRLYLRSLYTIRSKLLDKLSLLCSAT
PNYFPPSIDSSILSEEQNFIFNKITQGCFSIVSGGPGTGKTFLAAQLILSLVKQQPKLRI
AIVSPTGKATSHIRQILMKYNIFDDMVLMQTVHHFLQEYAYRRYNSIDVLLVDEGSMVTF
DLLYSLVQTLQGYEKDKKLYTSSLIILGDTNQLPPIGIGVGNPLQDLIGYFHENTFFLKT
SHRAKTGVVDQLTQSVLRGEMISFSPLPSISSAIEVLKNRFVKSLRQSEARLCVLTPMRH
GPWGVLNLNTMIHQRLARSDPDLRIPIMVTSRYETWGLFNGDTGLLCLKTQKLHFPQHEP
IDSRALSQYVYNYVMSVHKSQGSEYDEVIVIIPKGSEVFGVSILYTAITRAKYRVSVWGD
PETLHKIIKKSNY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgcacacagaatttgctccttttttagaagacttagtacatcagcaggtgatatcccct
ttagacatcgcttttgcttctaagcacatctcttcggactttgaagagtcttttgttttt
ctcgcggtctcctcagcgctttggcgttatggtcatccttttctttcccttgaggaaaat
cgcattagaccttctctaggagggatctcagaaacagatttgtatcggggatttcataac
cttcctaaggaagttcgagataaattatttgtcgttgtttcaggacgtttgtatttacgg
tctctgtatacgatacgatcgaaactcttagacaagctttcgttgctttgttcagcaacc
ccgaattattttcctccttctatagattcttcgatcctttcagaagagcaaaactttatt
tttaataaaataactcaaggatgtttttctatagtttctggaggcccaggaacaggaaaa
acttttttagctgcacaactcatcctctctttagtgaagcagcaacctaagttacgtatt
gctatagtatctcctacaggaaaggccacgtctcatattcgtcagattcttatgaaatat
aatatatttgacgacatggtgttgatgcagacggtgcaccactttcttcaggagtatgcg
taccgtcgctataactctatagatgtccttttagtagatgaaggctctatggtaactttt
gacttgttgtatagtttggtacaaaccctacagggatatgagaaagacaaaaaactttat
acctcgagtttaattattctcggagataccaatcaattgcctcctattggcattggggtt
ggaaatccccttcaagatctcataggatatttccatgaaaatacgtttttcctgaagaca
tcgcatagggcaaagactggagttgtggatcagctgactcaatctgtattgcgtggcgaa
atgatttctttttctcctctcccatcgatatcctcagctatagaagtcttgaaaaatcgt
tttgtaaagtcgttacgtcaatcagaagcacgtttgtgtgtattgactcctatgcgccat
ggcccttggggggttctgaacttaaacacaatgatacatcaaagattggcgagaagcgat
cctgatttacgtattcctattatggtgacgagtcgttatgaaacttggggactatttaat
ggagacacaggattactgtgtttaaaaactcagaaattgcatttccctcaacatgaaccc
atagattctagggctctatcacaatacgtctacaattacgttatgtctgtacacaagagc
caggggagtgaatacgatgaggttattgtaattattcccaagggaagcgaagtgtttggg
gtgtctattctctatactgcaattacccgagctaaatatagagtttcagtttggggagat
cccgagacgttacataagataattaagaagtctaattactag

DBGET integrated database retrieval system