KEGG   Carica papaya (papaya): 110817476Help
Entry
110817476         CDS       T05151                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00052  Galactose metabolism
cpap00500  Starch and sucrose metabolism
cpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110817476
   00500 Starch and sucrose metabolism
    110817476
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110817476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N DUF3357 Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 110817476
NCBI-ProteinID: XP_021901709
Position
Unknown
AA seq 561 aa AA seqDB search
MDTRLPIYDPLPDGPHSAGDPPNPRRPIKSCLAIFSGFLLVAFLVAFFAFSNVPGSLNDS
INEREAHTSQNGASLSSESTESSKILRPGSRGVSAGVSEKTNRLLFAGVEELKEFPWNNS
MLSWQRTAFHFQPEKNWMNDPNGPMFYKGWYHFFYQYNPNGAVWGDIAWGHAVSKDLIHW
LYLPIAMVPDQWYDSNGVWSGSATILPDGQIVMLYTGSTNESVQVQNLAYPADLSDPLLI
NWVKYSGNPVLVPPPGIHYKDFRDPTTAWLTSEGKWRIIVGSKVNKTGISLVYDTKDFKN
FKLLDSILHGVPGTGMWECVDFYPVSKISQNGQDTSMNGPEVKHVLKASLDNTRNDHYAI
GTYFDNKATWVPDNPEMDVGIGLRYDYGTFYASKTFYDQDKHRRILWGWITESDSEAADV
KKGWASLQCVPRTLVLDQKTGANLLQWPVEEIDSLRLNSNEFVNIKVKPGSVVPLDVGPA
TQLEGEKLSVRILVDHSIVESFAQGGRSAITSRVYPTRAIYGAARIFLFNNATDVSINAS
LRVWQMNSAFNRPYPNVPQNK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggatacacggttgcccatttatgatcctctccccgatgggccgcactccgccggtgat
ccgcccaatcctcggcgacccattaaatcttgcctcgctatcttctctgggttcttactt
gttgcctttttagtcgcttttttcgccttttctaatgtcccgggttcacttaacgacagc
attaacgaaagagaggcccacacaagccagaatggagcctcattgtcgtcggagtccacc
gaatcctccaagatactgcgacctgggtctcgcggcgtctccgccggcgtgtcggagaag
accaaccggctgttgttcgccggagtggaagagttgaaggagttcccttggaacaatagc
atgttgtcgtggcagagaacggcctttcattttcaacctgagaaaaactggatgaacgat
cctaatggtccaatgttttacaagggatggtaccatttcttctatcagtacaacccaaat
ggtgctgtgtggggtgatattgcgtggggacatgctgtttcgaaggatttgatccactgg
ctatacctgccaatagcaatggtccctgatcaatggtatgactcaaatggtgtctggtct
ggatctgctaccatcctcccagatggccagattgttatgctatatactggctcaacaaat
gaatcagttcaggtgcaaaatctggcataccctgctgatctttctgatcccctcctcatc
aattgggtcaagtactctggcaacccagttctggtccctccacctggcattcattacaag
gattttcgtgacccaacaaccgcttggttgacatcagaagggaagtggcgtattattgtg
gggtctaaagttaacaagaccggcatatctttagtctatgacaccaaggacttcaaaaat
tttaagctgttagattcaatccttcacggtgtccctggcactggcatgtgggagtgtgtg
gacttttaccctgtctcaaaaataagtcagaatggacaggacacatcgatgaatggccct
gaagtcaagcatgtgctcaaggcaagcttggataatactaggaatgatcattatgcaatt
gggacttacttcgacaacaaagccacttgggttcctgataatcctgagatggatgttgga
attggtctgcgttatgactatgggaccttctatgcatccaagaccttttatgatcaggat
aagcatagaagaatattgtggggttggattacagagtctgacagtgaagctgctgatgtg
aagaagggatgggcgtcccttcagtgtgttcctaggacactggttcttgatcagaagact
ggtgccaatctacttcaatggccagtggaggagattgacagtttgagactaaacagcaac
gaattcgtgaacatcaaggtgaagccaggctcggtggttccacttgatgttggcccggcc
acccagctagaaggtgaaaagctgtctgtaagaatactggtggatcattcaatagttgaa
agctttgcacagggagggaggtctgccattacatcaagggtttatccaacaagggcaatt
tatggagctgctagaatcttcttgttcaacaatgccaccgacgtcagcattaatgcctct
ctcagagtctggcaaatgaattctgcatttaatcgtccatacccaaatgttccacaaaac
aaatga

DBGET integrated database retrieval system