KEGG   Carica papaya (papaya): 110823556Help
Entry
110823556         CDS       T05151                                 

Definition
(RefSeq) acid beta-fructofuranosidase 1, vacuolar-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00052  Galactose metabolism
cpap00500  Starch and sucrose metabolism
cpap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110823556
   00500 Starch and sucrose metabolism
    110823556
Enzymes [BR:cpap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110823556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 110823556
NCBI-ProteinID: XP_021909647
Position
Unknown
AA seq 652 aa AA seqDB search
MGTKQAHDLEDDRAPPYAPLPDRPSAEGSPAILRLPLKGFAMIFACVIFLFSLAALIVDQ
TRKQVVLPPTSNKEYNVIPLSSMTPETTSFLRARGVAEGVSAKSNPALSGHEASFNWTNA
MLSWQRTAYHFQPERNWMNDPNGPLFHMGWYHLFYQYNPDSAVWGNITWGHAVSTDLIHW
LYLPIAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTVDSVQVQNLAYPANLSDPLLL
EWVKYPGNPVMVPPPGIGLKDFRDPTTAWLGHDGIWRITIGSKVNKTGISLMYQTTNFTT
YTLLEGFLHAVPGTGMWECVDFYPVATNGSVGLDTSANGAGIKHVLKASLDDTKEDVYAI
GTYDPVEDKWIPDNPNEDVGKGLKIDYGRYYASKTFFDPKKKRRILWGWINETDTEANDV
KKGWASVQTIPRTVLFDNKTGRNILQWPVEEVESLRLNSTVFDDVIVSPGSIMQLDIGPA
TQLDIIAEFETEPVGEIIHDPNGDYSCKGGGAVDRSSLGPFGLLVNADERLSELTPVFFR
PTNTTDGSLRTYFCADETRSSEAPDVFKRVYGSTVSVLKHEKLTMRVLVDHSIVESFGQG
GRTAITSRIYPTKAIYGAARLFLFNNATTVNVRAKVKVWEMNSAFIHPFPYD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgggcactaagcaagcccatgaccttgaagatgatcgcgcgccaccctacgctccgttg
ccggaccgaccatctgctgaaggatctccggcgattctccgactacccttgaagggtttt
gctatgatctttgcatgtgtcattttcctattttctctggcggcgttaatcgttgaccaa
accaggaagcaagttgtactgcctcccacatcgaacaaagagtacaatgttattcccctg
tcgtctatgacgccggaaactacgtcgtttttgagggctcgaggggttgcggagggtgtc
tcggccaaatcgaacccggctttgtcgggtcatgaagcgtcgtttaattggacgaatgcc
atgttgtcttggcaaagaacggcttaccattttcaacctgaaagaaattggatgaacgat
cctaatggtccattgttccacatgggatggtaccatctcttttatcaatacaatcctgat
tcggccgtatggggaaatatcacgtggggccatgctgtatcaacagacctgattcattgg
ctctacctcccaatcgctatggtcccagaccaatggtacgatatcaacggtgtttggact
gggtccgccactatccttcctgatggtcagatcatgatgctgtacaccggtgatactgtc
gattcggtgcaggtgcaaaaccttgcatatcccgccaacctatctgatcctctccttctt
gaatgggtcaagtaccccggcaacccggttatggtccctccgccgggtatcggactcaaa
gattttcgcgacccgacaactgcatggctcggccatgacggaatttggcgaatcacaatc
ggttcaaaagtcaataaaacaggaatttcactcatgtatcaaactactaacttcaccact
tacacgctactagaagggttcttgcatgcagttccgggtacgggtatgtgggagtgcgta
gacttttacccagtggcgacaaacgggtcggttgggttggatacttcagctaatggagcc
ggaatcaagcatgtgttaaaggctagcttggatgatactaaggaggatgtttatgcaatt
ggaacatacgaccctgtagaagataaatggatacccgataacccgaatgaggatgtgggt
aaagggttgaagatagattatggaagatattacgcgtctaaaacattctttgacccgaag
aagaagagaaggatattatggggttggattaacgagacagatactgaagctaatgatgtt
aaaaaaggatgggcatccgttcagacaatcccaagaacggtgttgtttgacaacaaaact
gggagaaatattctccaatggccggtggaggaagtagaaagtctaagattgaacagtacg
gtatttgatgatgttattgtgtctccaggatccatcatgcagctcgacattggacctgca
acacagctagatataattgcagagtttgaaacagaaccagtgggagaaataatacatgac
ccaaatggagattacagttgcaagggtggtggtgcagtagataggagcagcttaggtcct
ttcggtctcttggttaatgctgatgagagactctctgagctgactccagtatttttccgc
cctacgaacaccactgatggctctcttagaacatatttttgtgccgatgaaacaagatca
tctgaggcccccgatgtgttcaaaagggtttatggaagcacggtttctgttctcaaacat
gagaaactaaccatgagagtgctggttgatcattcaattgtggaaagctttggacaagga
gggaggacggcgatcacatctcggatttacccaacaaaagcaatctatggagccgcaagg
ctcttcttgtttaacaatgcaacgacggttaatgtgagggcgaaggttaaagtttgggaa
atgaattctgctttcattcatcccttcccatatgattaa

DBGET integrated database retrieval system