KEGG   Clostridium pasteurianum: Clopa_0694Help
Entry
Clopa_0694        CDS       T02645                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cpas  Clostridium pasteurianum
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:cpas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Clopa_0694
  Lipid metabolism
   00561 Glycerolipid metabolism
    Clopa_0694
   00600 Sphingolipid metabolism
    Clopa_0694
Enzymes [BR:cpas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Clopa_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(700594..702786)
Genome map
AA seq 730 aa AA seqDB search
MSIVYDENTKSFHLKAGNSSYIMQIHDENYLTHLYWGRKLRSFNAKELFSIKRRGSFSPN
PDPDNELLSLDTLPQEYPAYGTSDFRVPAYSVQLENGSTITDLRYASHKIIEGKPNLEGL
PATYVESDDEADTLEIVLQDSLIGLKAILSYTAYKNYDVITRNVRFQNSGNTKLKLLSAL
STSIDFDHCNYDFMHLHGAWARERLIERTPLINGNQSVESRRGASSHQHNPFVAILSKDA
TEEHGDVYGFNLVYSGNFIAQAEVDQYKTTRVSIGINPFDFSWILEPGEAFQTPEAVMVY
SSKGLGEMSRTYHKLYRSRLCRGNFRDKSRPVLVNNWEATYFNFNAEKIENIASVAKELG
IELFVLDDGWFGKRDNDDCSLGDWVVDKNKLPNGLDDLAKRINNLDLKFGLWFEPEMVSP
NSDLYRAHPDWCLHVPDRRRTQARKQLILDLSREDVCDYIIKSVSDILSIVNIEYVKWDM
NRNMTEIGSESLSPERQRETAHRYILGLYKIYEKLTSDFPNVLFEGCSGGGGRFDAGILY
YMPQIWTSDDTDAVERLKIQYGTSIVYPISTMGSHVSAVPNHQVHRNTPLKMRGDVAMSG
NFGYELDLTKFSEEEKEIVKNQVKEYKSLREFIQFGDMYRLISPFKRSEAAWIVVSEDKT
QAFAAYFRVLATPNEPISKIQFRGLDPDKDYSIEGKEGTFSGDELMYSGLVIPDLEGDYQ
SITWVLRSEG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgtttatgatgaaaatacaaaatcttttcaccttaaggctggaaacagcagt
tatataatgcaaatacatgatgaaaattatcttactcacctttactggggaagaaaactc
agaagctttaatgctaaagaactattctccattaaacgaaggggctccttttccccaaat
cctgatcctgataatgaattactatcccttgacacattgcctcaggaataccctgcttac
ggtaccagtgatttcagagtacctgcatattccgttcaactggaaaatggatcaactata
actgatttgagatatgcttctcataagattatagaaggtaagccaaatcttgaaggtcta
cctgccacttatgtagaaagtgacgatgaagctgatactttagagatagtgttacaggat
tccttgataggcctaaaagcaattttatcctacacagcttataaaaattatgatgtaatt
accagaaatgtacgttttcaaaatagcggtaatacaaaattaaagctgctcagtgcctta
agcactagtattgattttgaccattgtaattacgattttatgcaccttcatggggcttgg
gcaagggaaaggctgatagaaagaactcctcttataaatggcaatcaatccgttgaaagc
agacgtggtgcaagcagccatcagcataatccctttgtggcaattctaagcaaggatgct
acagaagaacatggagatgtatatggttttaatctggtttatagtggaaatttcatagca
caggcagaagttgatcaatataaaactactagagtatctattggtataaatccttttgat
ttctcctggattttagaacctggtgaagctttccagacaccggaagctgtgatggtttat
tcctcaaaaggactaggtgaaatgtccagaacttatcataaactctaccgcagcagattg
tgtagaggaaatttcagagataaatcaagacctgttcttgttaacaactgggaagcaact
tacttcaattttaacgcagaaaaaatagaaaatattgcttcagttgctaaagaacttggc
attgaactatttgtactggatgacggttggtttggaaaaagagataacgatgactgctct
ttaggtgattgggtggttgataaaaataaacttcctaatggtttagatgatctggcaaag
cgaataaataatttggatttaaaattcggcttatggtttgagccagaaatggtatcccct
aacagtgatttatatagagctcatccagattggtgtcttcatgtacctgacagaagacgt
acacaggcaagaaaacagctgatactggatctttcccgtgaggatgtatgtgactatatt
ataaaatcagtatcagacattttaagcattgttaatatagaatatgttaaatgggatatg
aatagaaatatgacggaaataggatcagagtctttatctcctgaaagacagcgagaaaca
gctcatagatatatactaggactgtataagatttatgaaaaactcacttctgattttcca
aatgtactctttgaaggctgctccggcggcggcggacgttttgatgccggtatattatat
tatatgcctcaaatctggaccagtgatgatacagatgcagtagaaagattaaaaattcaa
tatggtaccagcatagtttaccctatcagtactatgggttctcacgtttcagcagttcct
aatcaccaggtgcatagaaatactcctctaaaaatgagaggtgatgtggctatgtccggt
aactttggctacgaacttgatcttacaaagttttctgaggaggaaaaggaaattgtaaaa
aatcaggttaaagaatataaatccttaagagaatttattcagtttggtgacatgtacaga
cttataagtccttttaaaagaagtgaagccgcttggatagtagtttctgaagataagact
caagctttcgctgcatatttcagagtacttgcaacgccaaatgaaccaataagcaaaata
caatttagaggccttgatccagataaagactactccattgaaggaaaagaaggtacattc
tctggagatgaattaatgtattcaggacttgtcattcctgatttagagggtgactatcag
agtattacctgggtgctaagaagtgaaggatag

DBGET integrated database retrieval system