KEGG   Clostridium pasteurianum: Clopa_0874Help
Entry
Clopa_0874        CDS       T02645                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cpas  Clostridium pasteurianum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:cpas00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cpas00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884445..885002
Genome map
AA seq 185 aa AA seqDB search
MGNFNFERTEIEGVYIIEPQVFGDNRGYFMETYNLDEFKEAGLDMAFVQDNQSKSKKGVL
RGLHFQTQHSQGKLVRVIKGEVFDVAVDLRKNSETYGKWVGVKLSDENKKQFYIPEGFAH
GFLVLSEEAEFVYKCTDLYHPEFEGGIAWNDPEVGIEWPTEGIKELIFSEKDKKWKTLTE
SKIQF
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaattttaattttgagagaacagaaattgaaggagtatatataatagaacctcag
gtgtttggagataacagaggttattttatggaaacttataatttagacgaatttaaagaa
gcaggattagatatggcttttgtacaagataaccagtctaaatccaaaaaaggtgttcta
agaggattacattttcaaactcagcattctcaaggaaaattagttagagtaataaaaggt
gaagtttttgatgtagcagtagatttaagaaagaattctgaaacctatggcaaatgggta
ggagtaaaattaagcgatgaaaataaaaaacaattttacattccagaaggttttgcccat
ggatttttagtactttcagaagaggctgaatttgtttataagtgtacagatttatatcat
ccagaatttgaaggtggaattgcctggaatgatccagaagtaggaattgaatggccaact
gaaggcattaaagagttgatattttcagaaaaagataaaaagtggaaaactttaactgaa
agcaaaatacaattttaa

DBGET integrated database retrieval system