KEGG   Clostridium pasteurianum: Clopa_1767Help
Entry
Clopa_1767        CDS       T02645                                 

Definition
alcohol dehydrogenase, class IV
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cpas  Clostridium pasteurianum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cpas00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Clopa_1767
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Clopa_1767
   00620 Pyruvate metabolism
    Clopa_1767
   00650 Butanoate metabolism
    Clopa_1767
  Lipid metabolism
   00071 Fatty acid degradation
    Clopa_1767
  Amino acid metabolism
   00350 Tyrosine metabolism
    Clopa_1767
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Clopa_1767
   00626 Naphthalene degradation
    Clopa_1767
Enzymes [BR:cpas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Clopa_1767
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Clopa_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801555..1804134
Genome map
AA seq 859 aa AA seqDB search
MKITKTDELDIMLEKVRAAQRKFSTYSQEQVDEIFRKAAMAAIDARIPLAKIAVEETGMG
LVEDKVIKNHFAGEYIYNEYKDEKTCGVIEKSEPYGITKIAEPIGVIAAIIPTTNPTSTT
IFKSLIALKTRNGILFSPHPRAKKSTVEAAKIILDAAVKAGAPEGIIGWIEEPSIELTHL
LMEKADITLATGGPSMVKSAYSSGKPAIGVGPGNTPVIIDETAHIKMAVSSIILSKTYDN
GVICASEQSVIVLDSIYDKVKKEFEERGAYIIKKNELDKMREVIFVNGSINPDIVGQSAY
KIASMAGINVPKTTRVLIGEVTSLGEEEPFAHEKLSPVLAMYNAKDFDDALNKAVVLVNL
GGLGHTSAIYADVVKAKDKIDRFSNAMKTVRTFVNIPAAQGASGDLYNFKIAPSFTLGCG
SWGGNSVSENVGPKHLLNIKTVAERRENMLWFRVPKKVYFKFGCLQFALRELKDLNKKRA
FIVTGKVLYGLGYVDAITKILEEIGIDFKIFTEVEQDPTLATARSGAEEMLRFKPDTIIS
LGGGSPMDAAKIMWVLYEHPEVNFEDLAMRFMDIRKRIYTFPKLREKAIMISVATSAGTG
SEVTPFAVITDEKTGVKYPLADYELTPDMAIVDAELMMNMPKGLTAASGIDALVHGIEAY
TSVLASEFTNGLALEAIRLIFEYLPQAYSEGATNEKAREKMAHASTMAGMAFANAFLGVC
HSMAHKLGSEHNIPHGIANGLLIEEVIRFNAVDNPVKQAPFPQYKYPNVIWRYARIADYL
KLGGNTDKEKVELLIKAIHELKEKLNIPLTIRDAGVSEKNFYATLDKISELALDDQCTGA
NPRFPLTSEIKQMLINAFD
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattacaaaaactgatgagttagacataatgttagaaaaagttagagccgctcaa
agaaagttttcaacttattcccaagaacaagttgatgagatctttagaaaagctgcaatg
gccgcaattgatgcaaggataccacttgcaaaaatagcagtagaagaaactggtatgggc
cttgtagaagataaggttataaagaatcatttcgcaggtgaatatatttataatgagtac
aaagacgaaaagacatgtggagttatagaaaaaagtgaaccttatggtattactaaaatt
gcagaaccaataggagttatagcagctataatacctacaaccaatcctacatctacaact
atattcaaatcattaatagcattaaaaacgagaaatggtatactattttcaccacatcca
agagctaaaaaatcaacagtagaagcagctaaaataatacttgatgcagcggttaaagca
ggtgcacctgaaggaataataggatggatagaagaaccttcaattgagctaacccacctg
ctaatggaaaaagcagatataacactggctacagggggaccatctatggttaaatctgct
tattcatctggtaaaccagcaataggagttggcccagggaatactcctgttataatcgat
gaaactgcacatataaagatggcagtaagttcaattatactttcaaaaacatatgataat
ggagttatctgtgcctcagagcaatcagtaatagttttagattctatatatgataaagtt
aaaaaggaatttgaagaaagaggcgcttatataattaagaaaaatgaattagataaaatg
agagaagtaatttttgtaaatggaagtataaatcctgacatagtaggtcaatctgcatat
aaaatagcttcaatggcaggaataaatgtacctaaaactacaagagttcttattggagaa
gttacttctttgggagaagaagaaccttttgctcatgaaaaattatctccagttcttgca
atgtataatgcaaaagactttgatgatgcattgaataaagctgtagtccttgttaattta
gggggactaggccatacttcagcaatatatgcagatgtagtaaaggcaaaagacaagata
gatagatttagtaatgctatgaaaacagtgagaacatttgttaatataccagcagcacaa
ggtgcaagtggagatttatataattttaagatagctccttcatttacactaggatgtggt
tcttggggtggaaattccgtatcagaaaatgttggacctaaacatcttttaaatattaaa
acagtagctgaaaggagagaaaatatgctttggtttagagtaccaaaaaaagtttatttt
aaatttggttgtcttcaatttgcattaagagaattgaaggatttaaataaaaaaagagcc
tttatagtaacaggtaaagttctttatggattaggatatgttgatgccattacaaaaatt
cttgaagaaataggtatagattttaagatatttactgaggtagaacaagatccaactttg
gctacagctcgaagcggtgctgaggaaatgttgagatttaagccagatactataatatct
cttggtggaggttctccgatggatgctgcaaaaataatgtgggtactatatgaacatcca
gaagtaaattttgaggatttagctatgagatttatggatataagaaagagaatatatact
tttccaaagcttagagaaaaagctataatgatatctgtagctacttctgcaggtacagga
tcagaagttactccttttgctgtaataacagatgaaaaaacaggagttaagtatccatta
gcagattatgaattaactccagatatggctattgttgatgctgaattaatgatgaatatg
ccaaaaggattaacagcagcatcaggtatagatgcattagtgcacggtatagaagcttat
acatcagtacttgcttctgaatttacaaatggactagccctagaagcaataagattaata
tttgagtacttacctcaagcatactcagaaggtgctacaaatgaaaaagcaagagaaaag
atggctcatgcatcaactatggcaggtatggcttttgctaatgcatttttaggtgtatgt
cattcaatggcacataaattaggttcagaacataacataccacatggaattgccaatgga
ttattaattgaagaagttattaggtttaatgcagtagataatcctgtaaaacaagcacca
tttcctcaatataaatatccaaatgttatatggagatatgcaagaattgcagattatcta
aaactaggtggtaacacagataaagaaaaagttgaacttttaattaaggctattcatgag
ttaaaagaaaaattgaatatacctttaactattagggatgcaggagtttcggaaaagaat
ttttatgcaactctagataaaatatcagaattagcacttgatgatcagtgtacaggagct
aatcctagatttccattgacaagtgaaattaaacaaatgcttataaatgcttttgattaa

DBGET integrated database retrieval system