KEGG   Clostridium pasteurianum: Clopa_3904Help
Entry
Clopa_3904        CDS       T02645                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cpas  Clostridium pasteurianum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cpas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clopa_3904
Enzymes [BR:cpas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Clopa_3904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3922874..3924328)
Genome map
AA seq 484 aa AA seqDB search
MAIKNKIMLITYADSLGKNLKELENVLTTYFKNAVGGVHILPFFPSSADRGFAPMNYEKV
DSAFGDWQDIEKLSENFYLMYDFMINHISRNSEYFKDFQENKDKSPYADFFIRYKDFWPK
GEPSQEDVDLIYKRKPRAPYIDVNFEDGTSEKIWCTFDSEQVDLNIKSEVTKKFIKDTLT
NMAKRNASLIRLDAFAYATKKVGTNCFFIEPDTWELLDEVKEILEPLNVDILPEIHEHYS
IQMKISEKGHWIYDFALPMIMLHALYSGVNKNLIKWLKMSPKKQFTTLDTHDGIGVVDVK
DLLTDEEVEITRESLFTKGANVKKIYNTTAYNNLDIYQVNCTYYSALGNNDDAYTLARAI
QFFAPGIPQVYYVGLMAGENDIKLLEETKVGRNINRHYYSKEEVEENMKRPVMKRLLKLM
EFRNSYAAFNGDYFISDINEAEVIEITWEKDEFKTTLKANLKTHKFTIGYFDVETKEFKE
LAEV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaaaataaaattatgcttattacttacgcagatagtttaggtaaaaattta
aaggaactagaaaacgttttgacaacttattttaaaaatgcagtggggggagttcatata
ttaccatttttcccatcatcagcagatagaggatttgcaccaatgaactacgaaaaagtt
gactcggcctttggcgattggcaagatattgagaaattaagtgaaaatttttatttaatg
tatgattttatgataaatcacatatcaagaaattctgaatactttaaagattttcaggaa
aataaagacaagtcaccttacgcagatttcttcattagatataaggatttctggcctaag
ggtgaaccttctcaggaagatgtagaccttatatataagagaaaacctagagcaccatac
attgatgttaattttgaagatggaaccagtgaaaaaatatggtgtacctttgatagtgag
caagtggatttaaatataaaatcagaagttacaaaaaaatttataaaagatacccttact
aatatggcaaagagaaatgcttcattaatcagacttgatgcttttgcctatgctactaaa
aaggttgggactaattgtttctttatagaacctgatacttgggaattacttgatgaagta
aaagaaatattggagccattaaatgtagatatattaccagaaatacatgaacattactca
attcaaatgaaaatatcagaaaagggtcactggatatatgattttgcactccctatgatt
atgctgcatgctctatacagtggtgtaaataaaaatcttataaaatggcttaaaatgtct
cctaaaaagcagtttactacattagatactcatgatggtattggggtagtggatgtaaag
gatttattgactgatgaagaagttgaaatcacaagggaatcactatttactaagggagca
aatgtaaagaaaatctataatacaactgcctataacaaccttgatatatatcaagttaat
tgtacctattattcagcacttggaaataatgacgatgcctatactttagcaagagctatt
cagttctttgcaccaggaatacctcaggtgtactatgtaggacttatggctggagaaaat
gatataaaattacttgaagaaacaaaggttggaagaaacataaatcgtcattactacagc
aaagaagaagttgaagaaaatatgaaaagacctgttatgaagagattactaaagcttatg
gagtttagaaattcttatgcagcttttaatggtgattacttcatatctgatataaatgag
gcagaagttatagaaataacttgggaaaaagatgaatttaagactactttaaaagctaat
cttaaaactcataaatttacaataggttattttgatgtggaaactaaagagtttaaagaa
ttggcagaagtttaa

DBGET integrated database retrieval system