KEGG   Clostridium pasteurianum: Clopa_4625Help
Entry
Clopa_4625        CDS       T02645                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cpas  Clostridium pasteurianum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpas01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cpas00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4687593..4688393
Genome map
AA seq 266 aa AA seqDB search
MNTRKEHIDNAKKIVVKVGTSTLTHENGLLNFDRIDKLARQLSDLHNQGKEVILVTSGAI
GVGTAKLGIKTKPETIPEKQAAAAIGQGILLHIYEKFFAEYGQIVAQILLTKDDITNKTR
YSNAKNTLNELLKQGVIPIVNENDVIATHEIKFGDNDTLSALVSSIVDADLLILLSDING
LYDSDPRANRDAKLISLVDEITKKIESFGGAPGSKLGVGGMYTKIKAAKIAVEHGVSMII
ANGSDDDVIKNIISNKEIGTLFSAHK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatactagaaaagaacatatagataacgcaaaaaaaatagtagtgaaagtaggtact
tcaacccttactcatgaaaatggacttctaaattttgatagaatagataaactagcaagg
cagctttcagatcttcacaatcaaggtaaagaagtcattctagtaacttctggtgccatt
ggtgttggtactgcaaaactaggaataaagacaaaacccgaaactatacctgaaaagcag
gcagctgctgcaattggccagggtattcttcttcacatttatgaaaaattctttgcagag
tatggtcaaatagttgcgcagattttacttaccaaggacgatataaccaataaaacaaga
tacagcaatgcaaaaaataccttaaacgaacttttgaaacagggtgttatacccatagta
aacgaaaatgatgttattgccacacatgaaataaaatttggagataatgacaccttatcc
gctttagtttcaagtatagtggatgctgatctccttatattactttcagatattaatggt
ttatatgattcagacccccgagcaaatagagatgctaaacttatatctcttgtagatgag
attacaaagaaaattgaaagttttggcggtgctcctggttcaaagcttggtgttggaggt
atgtacactaaaattaaagctgcaaaaattgcagtagaacatggtgtatcaatgataatt
gcaaatggttctgatgacgatgtaataaaaaatataatatcaaataaagaaataggtacg
ctcttttcagcacataaatag

DBGET integrated database retrieval system