KEGG   Clostridium pasteurianum DSM 525 = ATCC 6013: CLPA_c08620Help
Entry
CLPA_c08620       CDS       T03753                                 

Gene name
thlA1
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpat  Clostridium pasteurianum DSM 525 = ATCC 6013
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cpat00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLPA_c08620 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CLPA_c08620 (thlA1)
   00640 Propanoate metabolism
    CLPA_c08620 (thlA1)
   00650 Butanoate metabolism
    CLPA_c08620 (thlA1)
  Lipid metabolism
   00071 Fatty acid degradation
    CLPA_c08620 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CLPA_c08620 (thlA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLPA_c08620 (thlA1)
   00310 Lysine degradation
    CLPA_c08620 (thlA1)
   00380 Tryptophan metabolism
    CLPA_c08620 (thlA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLPA_c08620 (thlA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLPA_c08620 (thlA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLPA_c08620 (thlA1)
Enzymes [BR:cpat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLPA_c08620 (thlA1)
Exosome [BR:cpat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLPA_c08620 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
946902..948080
Genome map
AA seq 392 aa AA seqDB search
MKEPVIVSAVRTAIGAFGKSLKDIPAVDLGAVVIKEAVKRAGIKPEEINEVILGNVLQAG
LGQNPARQAAIKAGLPTEIPAFTLNKVCGSGLRTVSLAAQIIKAGDADIIVAGGMENMSR
APYLVDNAGFGYKMGNGQFIDEMIKDGLWDAFNDYHMGITAENIAEKWEITREEQDEFSV
KSQNKAEKAIKSGEFKDEIVPITVKTRKGEFVFDTDEQPRFGSNVESLSKLRPSFKKDGT
VTAGNASGLNDGAAALVIMSAEKAKELSIKPLAKIVSYASSGLDPKIMGYGAFYATKAAL
DKIDLKAEELDLIEANEAFAAQSIAVTRDLKIDLNKVNVNGGATALGHPIGGSGARILAT
LLHAMQKRDVKRGLATLCIGGGQGTALIVERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacctgtaatagttagtgcagtcagaacagccataggagcctttggaaaaagc
cttaaggatataccggcagtggatttaggagctgtagtaataaaagaagcagttaaaagg
gcaggaataaaaccagaggaaatcaatgaagttattttagggaatgttctccaggcaggg
ttaggtcagaatccagcaagacaagcagcaataaaagcaggattgcctacagaaattcca
gcttttactcttaataaagtatgtgggtcaggcttaagaactgttagcttagcagctcaa
ataatcaaagctggggatgcagatataattgtagcaggtggtatggagaatatgtcaaga
gcgccttatttagttgataatgctggatttggttataaaatgggtaatggacagtttatt
gacgaaatgatcaaggatggtttatgggacgcctttaatgactatcatatgggaataact
gctgaaaacatagcagaaaagtgggaaataacaagagaagagcaagatgaattttcagtt
aaatcccagaataaagctgaaaaggctataaagagtggagagtttaaagatgaaatagta
cctataacagtaaaaacaagaaaaggtgaatttgtatttgatacagatgaacaaccaaga
tttggaagcaatgtggagtcattatcaaaattaaggccatcttttaaaaaagatggaacg
gttactgcgggaaatgcatctggactaaatgatggagcagctgcattagttataatgagt
gcagagaaagcaaaagaattaagcataaagccgctagctaagattgtttcttatgcatca
tctggattagacccaaagataatgggttacggtgctttttatgctacaaaagctgcttta
gataaaatagacttaaaagctgaagaattagacctaattgaagccaatgaagcttttgca
gctcaaagtatagcggtaacaagagatttaaaaattgatttgaataaagtaaatgtaaat
ggaggagcaacagcattaggacatcctataggaggttctggagcaagaattttagctaca
ttattgcatgctatgcagaaaagagatgtaaagagaggactagctacattgtgcataggt
ggaggacagggaactgcattaatagttgaaagagactaa

DBGET integrated database retrieval system