KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0295Help
Entry
Cphamn1_0295      CDS       T00709                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cphamn1_0295
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphamn1_0295
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cphamn1_0295
Enzymes [BR:cpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cphamn1_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(286427..287746)
Genome map
AA seq 439 aa AA seqDB search
MIFYSTNKQSTPASLKKATLEGLASDGGLYIPSAIPTFSKEEIALLEDAPFNDIAFAIAK
KFNGGEIPDDHLWQIIESCFTFNTPLVELEKNTYVEELFHGPTLAFKDYGARFLAHLTGY
FAQEDHTLITILVATSGDTGSAVAYGFKGVPNTRVVLLYPSGKVSRLQEQQLTTVGGNVT
ALEIYGDFDDCQRLVKQAFMDAELKQRLSLTSANSINISRLIPQTFYYAWGSLQLKARHP
GKEALFSVPSGNYGNLTAGVLAKKMGFPIAHFIAGSNANDSVTRYLEEGRYEPHPTIGTL
SSAMDVGNPSNFARLRHIYGDDYRAMAADISGHAISDTETLDTIRTVYDRFGYIMDPHTA
VGFRALEKFRQANGASTEPAAIMSTAHPAKFIEAIKEALDRDITIPDRLQAVLDRKKIAI
PISADYRELTEFLTGLDDR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgattttctacagcaccaataaacagtccacgcccgcttcgctgaaaaaggccacgtta
gaggggctggcaagtgacggaggcctctatatcccctctgcgattccaaccttttcaaag
gaggagattgcgctgctcgaagatgctccgttcaacgatatagcatttgcaatcgcaaaa
aaattcaacggtggagaaattcccgacgaccatctgtggcaaataattgaaagctgcttt
acgtttaacactccgcttgtcgaacttgaaaagaacacctacgtcgaagaactttttcat
gggccgacacttgctttcaaggattacggcgcacgatttctcgcgcatctcaccggttat
ttcgcccaggaagaccatacgctcataaccattctcgtcgcgacatccggcgatacaggc
agcgctgtcgcttatggattcaaaggcgtcccgaatacgcgcgtggtactactctaccct
tccggcaaggtcagcaggcttcaggaacagcaactcacgacagtcggaggcaacgtaacc
gcactggaaatatacggagacttcgacgactgccaacgcctcgtcaaacaggcatttatg
gacgcggaactcaaacagcggttgtccctgacatcggccaactctatcaatatttcccgt
cttatcccgcaaacattttactacgcctggggatcgttgcagctcaaagccaggcatccg
ggaaaagaagctcttttttcggtcccgagcggcaattacggcaacctcactgcaggcgtc
cttgcaaaaaaaatggggtttcccatcgcacatttcatcgcaggctccaatgccaatgac
agtgtgacgcgttatctcgaggagggacgatatgagcctcaccccacaattggaaccctg
tcatcggcaatggatgtgggcaacccgagcaattttgcccggttgagacatatttacggg
gatgactaccgggcaatggcagctgacatttccggacacgccatctccgacaccgaaacc
cttgacacaatcagaacagtctacgaccggttcggctatatcatggacccgcacaccgcc
gtcgggttccgggcacttgaaaagttcagacaagccaacggcgcgtcaaccgaacccgcc
gccatcatgtcaaccgcacacccggcgaagttcatcgaagccatcaaggaagctctcgac
agggatatcactattcccgaccgccttcaggcagttctcgacagaaaaaaaatagccatc
ccgatcagtgccgactacagagaactcacagagttcctgaccggacttgatgacaggtaa

DBGET integrated database retrieval system