KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0298Help
Entry
Cphamn1_0298      CDS       T00709                                 

Definition
F0F1 ATP synthase subunit gamma (EC:3.6.3.14)
Orthology
K02115  
F-type H+-transporting ATPase subunit gamma
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cpb00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
290569..291456
Genome map
AA seq 295 aa AA seqDB search
MATLKDIRTRIQSIASTQQVTKAMKMVSAAKLRRAQDSAIQARPYAAKLKEMLGSLSTRV
DTTLNPLLSDRDEVKNVLVVVITSDRGLCGAFNANIIKIAQKVVTEEHGDLYRDGKVEML
CAGSKGNDYFRKRGFSISKAYPGLFQNLHFSVAREIAEYASERYLKGEVDKVVVVYNEFK
SVLAPVLKSEVLLPITPEKVEGEKTGSSIDYIYEPSPSAIIDVLVPKHLNTQIWRMMLES
NAAEHASRMTAMDSATENAKELMRVLKISYNRARQAAITTELSEIVAGAEALQGE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccttaaaggatatacgaactcgaatacagagtattgcatcgacgcagcaggtc
accaaggcgatgaaaatggtttctgccgcgaagcttcgcagggcacaggattcggcaatt
caggctcgtccttacgctgcaaagctgaaagagatgctcggttcgctgtcaaccagggtg
gatacgacgttgaacccgttgctttctgaccgtgacgaagtgaaaaacgtccttgttgtc
gtgattacttcggacaggggactttgcggggcattcaatgccaatatcataaaaattgcc
cagaaagtcgttacggaagagcatggcgatctttaccgtgacggcaaggtggagatgctc
tgtgccggctccaagggaaatgattatttccgcaagcgtggtttcagtatctccaaagcc
tatccggggctcttccagaaccttcatttcagtgtcgccagagagatcgctgaatatgct
tctgaaagatatctcaagggagaggtcgacaaagttgtcgttgtttataacgagttcaag
tctgttctggcacctgtattgaaaagcgaggtgctgcttcctatcacgccggaaaaagtg
gaaggggagaaaacagggagctcgatcgactatatttacgaaccttctccttcagctata
atcgatgttcttgtacccaagcatcttaatacacagatctggagaatgatgcttgaatcc
aatgccgcggaacatgcctcgcgtatgaccgctatggattctgctaccgagaacgctaaa
gagttgatgagggttctgaagataagttataaccgtgcgcgccaggctgctatcactaca
gaactcagtgagattgtcgcgggtgctgaggcattgcagggagaataa

DBGET integrated database retrieval system