KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0356Help
Entry
Cphamn1_0356      CDS       T00709                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cphamn1_0356
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphamn1_0356
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphamn1_0356
Enzymes [BR:cpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cphamn1_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(369040..370431)
Genome map
AA seq 463 aa AA seqDB search
MSSEPTKILLHEDEMPRQWYNIQADLPTPIPLPLGMDGKPINPEDLAPVFPMNIIEQELS
TERWITIPEKVRELLTLWRPSPLYRAKGLEKALNTPARIYYKNEGVSPAGSHKPNTAVAQ
AYYNKEFGIKYLTTETGAGQWGSALAMSCKLVGIECKVFMVRISFDQKPFRKIMMKTWGA
DCIASPSETTGIGRKILAEQPDTPGSLGIAISEAIEEAVQREDTRYSLGSVLNHVMLHQT
IIGLEAQKQFDKINRYPDIVIGCAGGGSNFAGISFPFIHDKINGKDLRVIATEPEACPTL
TRGPYVYDSGDVAKMTPLLAMHSLGHGFIPPSIHAGGLRYHGMAPLVSHVLQQGLIEANA
LPQTECYKAALLFAHTEGFIPAPETSHAIAQTIREANRAREEGKEKTILMNWSGHGLMDL
QGYDAFMSGKLEDYPLPEELLQQSLADIKDHPKPPVSPCHSRA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagaaccaacaaagatcctgttacacgaggatgaaatgcctcgtcagtggtac
aacatccaggcagaccttcctacccctatacccttacccctcggcatggacggcaagccg
atcaatcctgaagaccttgcgccggtcttccccatgaacattattgaacaggaactcagc
accgaacgctggattaccattcccgagaaggtccgggaacttctcactctctggcgccct
tctccgctctacagagccaaaggccttgaaaaagcactgaatactccagccaggatctac
tataaaaacgaaggtgtttcaccagccgggagccataaaccaaacaccgctgtcgcccag
gcatattacaacaaggaattcggcatcaaatatctgacaaccgagaccggtgccggtcaa
tggggaagcgcgcttgcaatgagctgcaagcttgtcggcatcgagtgcaaggtgtttatg
gtgcgcatcagctttgatcagaaaccgttcaggaaaatcatgatgaaaacctggggtgcc
gactgcattgcgagcccgagcgaaacaaccgggatcggacgtaaaatcctggctgaacag
ccggacactcccggaagtctcggcattgcgatcagcgaagctatcgaggaagccgtccag
cgagaggatacccgctactctctcggcagcgtcctgaatcatgtcatgctgcatcagacg
atcatcgggctggaagcacagaaacagttcgacaaaatcaaccggtacccggatatcgtt
attggctgcgccggcgggggctccaacttcgcaggaatcagtttcccgttcattcatgat
aaaatcaacggaaaagatcttcgtgtgatcgcaaccgagcccgaagcctgcccgaccctc
acaagaggaccgtatgtctatgactccggagacgtagcgaaaatgactcctctgcttgcg
atgcacagcctcggtcacggctttatccccccttcgattcatgctggagggcttcgttac
cacggtatggccccactggtcagccatgtgctgcagcaaggccttattgaagcaaacgca
ctgccgcagactgaatgttacaaggctgcactgcttttcgcccatacagaagggttcatt
cccgctccggaaacctcgcacgctatcgcgcaaactatacgggaagcaaaccgtgcacgc
gaagagggaaaagaaaagactattctgatgaactggtccggtcatgggctcatggacctg
cagggatacgacgccttcatgtcgggaaaactcgaagactatcctttgccggaagaactc
ctgcaacagtcgctggcggacatcaaggatcatccgaagccacccgtctctccctgtcat
tcccgtgcctga

DBGET integrated database retrieval system