KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0408Help
Entry
Cphamn1_0408      CDS       T00709                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00230  Purine metabolism
cpb01100  Metabolic pathways
Module
cpb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cphamn1_0408
Enzymes [BR:cpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cphamn1_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 AAA_18 YAF2_RYBP NTPase_1 AAA RsgA_GTPase Cytidylate_kin AAA_30
Motif
Other DBs
NCBI-ProteinID: ACE03373
JGI: Cphamn10408
UniProt: B3ELP4
Position
432741..433316
Genome map
AA seq 191 aa AA seqDB search
MTDRQGKLIVFSAPSGTGKSTVARKVLERVEGLEFSVSATTRSRREGEVDGKNYYYLTKK
AFEEIIDSDGFIEYEHFFGNFYGTLLDKTEAAVASGKHMLFDLDVKGALNLKKHFPENTL
LLFLKPPSLQELKKRLDGRESEDEDALNERLKRAEFELSFAHQFDHEVVNDNLSRAVDEV
TALITDFLSKQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaggcaggggaaattaattgtcttttcggctccttctggaactggtaaatca
acagtcgccaggaaagttcttgaacgcgtcgagggactcgaattttcggtatccgcaacc
acccggtcgaggcgtgaaggtgaagttgacggaaaaaattactattatcttacaaagaag
gcttttgaagagatcatcgacagcgatggatttattgaatatgagcacttctttggcaac
ttctacgggacactgctggataaaacagaagctgctgttgcttccggaaagcatatgctg
tttgatctggatgtgaagggcgcattgaacctgaaaaagcattttccagaaaacacgcta
ttgctttttctgaaacctcccagccttcaggagttgaaaaaaaggctcgatggcagggag
agcgaggacgaagacgcgcttaatgaacggttgaagagagccgagtttgaactctctttt
gcgcaccagtttgaccatgaagtggtcaatgacaacttgagccgcgctgtagatgaagta
acggcgctgatcactgattttctttcaaaacaataa

DBGET integrated database retrieval system