KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0422Help
Entry
Cphamn1_0422      CDS       T00709                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cphamn1_0422
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cphamn1_0422
DNA repair and recombination proteins [BR:cpb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Cphamn1_0422
    RecFOR pathway proteins
     Cphamn1_0422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH_2 HHH Transposase_20 BID
Motif
Other DBs
NCBI-ProteinID: ACE03387
JGI: Cphamn10422
UniProt: B3ELQ8
Position
445907..446509
Genome map
AA seq 200 aa AA seqDB search
MFTYFRGELIEASPDEAVIEVSGVGYLLSISATTYRQLPEPGREVLVLAHLHVKEDLMQL
FGFLEEEERQLFRLLLSISGVGPKLALAILSGLQVHEIQEAIVSNMPERLFEITGVGKKT
AARIVLELRDRILKLRPSGGTKSVSRLSESSMRDDAVNALVTLGFLRSVAQKAVTESLTS
LRNPQVEDLVRDALLTIRTP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatactttcgtggtgagctgatagaggcttctcctgatgaggcggttatcgag
gtctccggggtaggttatcttctttcgatctctgcgaccacctatcgtcaactccctgag
cctggaagagaggtgctggttcttgcgcaccttcatgtcaaggaagatctgatgcagctc
tttggttttcttgaagaagaagagcgtcagcttttcaggctcctgctttcgatttcaggc
gtcggaccgaaacttgcgctcgctatcctttccggattacaggtgcacgagatacaggag
gctattgtgtcgaatatgcctgagagattgtttgagattacaggtgtcggtaaaaaaaca
gcagccaggattgtccttgaactgcgtgacagaattcttaaacttcgtccgtcagggggg
acaaaatcagtatcacgtctatcagaaagctccatgcgtgatgacgctgtaaatgccctg
gtgacgctcggttttttgcgatctgtcgcacaaaaggcggttactgaatcattgacatcc
ctcagaaatccgcaagtggaggatctggtaagggatgcactgctcactattcgaacccca
tga

DBGET integrated database retrieval system