KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0422Help
Entry
Cphamn1_0422      CDS       T00709                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
445907..446509
Genome map
AA seq 200 aa AA seqDB search
MFTYFRGELIEASPDEAVIEVSGVGYLLSISATTYRQLPEPGREVLVLAHLHVKEDLMQL
FGFLEEEERQLFRLLLSISGVGPKLALAILSGLQVHEIQEAIVSNMPERLFEITGVGKKT
AARIVLELRDRILKLRPSGGTKSVSRLSESSMRDDAVNALVTLGFLRSVAQKAVTESLTS
LRNPQVEDLVRDALLTIRTP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatactttcgtggtgagctgatagaggcttctcctgatgaggcggttatcgag
gtctccggggtaggttatcttctttcgatctctgcgaccacctatcgtcaactccctgag
cctggaagagaggtgctggttcttgcgcaccttcatgtcaaggaagatctgatgcagctc
tttggttttcttgaagaagaagagcgtcagcttttcaggctcctgctttcgatttcaggc
gtcggaccgaaacttgcgctcgctatcctttccggattacaggtgcacgagatacaggag
gctattgtgtcgaatatgcctgagagattgtttgagattacaggtgtcggtaaaaaaaca
gcagccaggattgtccttgaactgcgtgacagaattcttaaacttcgtccgtcagggggg
acaaaatcagtatcacgtctatcagaaagctccatgcgtgatgacgctgtaaatgccctg
gtgacgctcggttttttgcgatctgtcgcacaaaaggcggttactgaatcattgacatcc
ctcagaaatccgcaagtggaggatctggtaagggatgcactgctcactattcgaacccca
tga

DBGET integrated database retrieval system