KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0512Help
Entry
Cphamn1_0512      CDS       T00709                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cphamn1_0512
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cphamn1_0512
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cphamn1_0512
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cphamn1_0512
Exosome [BR:cpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cphamn1_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
533662..535167
Genome map
AA seq 501 aa AA seqDB search
MQRNKNKRGFLSSLVMGIMMSMLVVSISGCDDDDGPDVVNAPSATDKTAKYIFFFIGDGM
ASPQVNLTEAALADPNFRLVNGAITLGAMNLQHFPVAGMATTHAEDRYITGSAAAATALA
TGEKTTIGTISKNVAHTQDLKAMAEMAKEKGMKVGIVSSVSIDHATPACFYAHENSRSNY
YNIASQMDDSGFDYFGGGYAKGDFGSKGPGDVDIQMENAGYEIVDNLGALQSVQPGQKCW
AYSDFDGDGALYYEIDRMGTNHISLAQFTEQGVRLLDNPNGFFMMIEGGKVDWACHANDA
VSATHDMVAFDDAIGIALDFYNQHPDETLIVVTGDHECGGLSLGFASTGYETAFNLLKHQ
DISYQEFSDLVVSWKGSGKTFDQALESVKEHFGLGDETVDPLLALSAYEEDQLKQAFDDS
MDPDFVRDSEEKYLKYGPYYDPFTVTVTHILNQKAGISWTSYSHTGVPVPVYAIGAGANS
FTGSYDNTDVAKKIIAVGTLN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtaacaaaaacaaaagaggctttttgagtagccttgtgatgggaatcatgatg
tcgatgctggttgtgtcgatctccggttgtgatgatgacgatggtccggatgttgtgaat
gctccgtcagccaccgacaaaacggcaaagtacattttcttttttatcggtgatggaatg
gcaagcccgcaggtcaatctgaccgaggctgctctggctgatccgaatttcagactggtc
aacggggcaattacccttggtgcgatgaacctgcagcatttcccggtagcgggtatggct
acgacgcatgccgaagatcgctatatcaccggttctgctgctgcggcaaccgcccttgca
accggcgaaaaaaccactatcggtaccatttcgaaaaatgtcgcacatacacaggatctg
aaagcaatggccgaaatggccaaggaaaaaggcatgaaggtaggcattgtttccagtgtg
agcatcgaccatgcaactccggcttgcttttacgcgcatgaaaacagcagaagcaactat
tacaatatcgccagtcagatggatgacagcggatttgactattttggcggcggttacgcg
aaaggtgactttggcagcaaaggccctggtgatgtcgatatccagatggagaacgccgga
tacgagatagtcgataatctcggagctcttcagtccgtgcagcccgggcagaaatgctgg
gcttacagtgactttgacggtgacggagctctctactatgagatcgaccgtatgggtacc
aatcatatctctcttgctcagtttacagaacaaggtgtcagactgctcgacaatccgaac
ggttttttcatgatgatcgagggcggcaaggttgactgggcatgccacgcaaacgatgct
gtcagcgcaacgcacgatatggtcgcttttgatgatgctatcggtatcgcgcttgatttt
tacaatcagcatccggatgaaacactcatcgtcgtaaccggtgatcatgaatgcggaggg
ctctctctcggttttgcttcaacaggatacgagacagctttcaatctgctgaaacatcag
gatatctcgtatcaggagttttcagatctggttgtttcctggaaaggaagcggcaagacc
tttgatcaggcgcttgagagtgtgaaagagcacttcggtcttggtgacgaaactgtggat
cctttacttgcgctgagtgcgtatgaggaggatcagctcaagcaggcttttgatgacagc
atggatcctgatttcgtgcgcgactctgaggagaagtacctgaagtacgggccctattac
gaccccttcacggtcaccgttacgcatattctcaatcagaaagctggtatcagctggaca
agttattcgcatacaggggttcctgttcctgtttacgcgatcggtgccggggcaaacagc
ttcaccggttcttatgacaatactgatgtggccaagaaaatcatcgcggtcggcactctc
aactga

DBGET integrated database retrieval system