KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0535Help
Entry
Cphamn1_0535      CDS       T00709                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cpb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
563812..564588
Genome map
AA seq 258 aa AA seqDB search
MTTYLTKILDYKSSEVDQLKQQDPASRYRDAASDLMPARDFAGALKNDQGSVKLIAEVKK
ASPSRGVMVEDFNPLDIARRYAGIGASAFSVLTDRHFFQGSNQYLQQVSASFDLPVLRKD
FIIDESQIYEARLIGADAILLIVAALDTFRLKDYLQLAAGIGLGVLVEVHDRSELDCALD
AGATVVGVNNRNLKDFSVSLDTSLLLRPAIPDDVISVAESGLKKISDVSLMQDASFDAVL
IGEGLLSSELQQFTWTRT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactacctatctgacaaaaatactggactataagtcttccgaggtagatcagcttaaa
cagcaggatcctgcatcccggtaccgtgacgcagcgtcggatctgatgccggcaagagat
tttgccggagccttgaaaaatgatcagggttctgtaaagctcatcgcggaagttaagaag
gcctctccgtcaagaggggttatggtggaggatttcaatccgcttgacatcgcgcgtcgt
tatgcagggataggggcttccgcgttttccgttcttaccgacaggcatttttttcagggt
tctaatcaatacctgcagcaggtgagtgcttcttttgatcttcctgtgttacgcaaggat
tttattatcgatgaatcacagatatacgaagcacgcctgataggtgccgatgctatcctg
cttatagtcgcagcgcttgacactttccggctcaaagactatttgcagcttgcggccgga
attggcttaggcgttcttgttgaagtgcatgacaggtctgaactggattgtgccttggac
gcgggagcgacagttgtcggagtcaataaccggaacctgaaggacttcagcgtttcgctc
gatacctcgcttcttctcaggcccgcaatacccgatgacgtgatctcggttgcggaaagc
ggcttgaaaaagatttccgatgtatccctgatgcaggacgcgtcgtttgacgctgtcctg
atcggagaaggattgctgagctctgaactgcagcagtttacctggacgcggacttga

DBGET integrated database retrieval system