KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0550Help
Entry
Cphamn1_0550      CDS       T00709                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphamn1_0550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_0550
   00620 Pyruvate metabolism
    Cphamn1_0550
   00640 Propanoate metabolism
    Cphamn1_0550
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cphamn1_0550
   00680 Methane metabolism
    Cphamn1_0550
Enzymes [BR:cpb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cphamn1_0550
Lipid biosynthesis proteins [BR:cpb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cphamn1_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(579880..581871)
Genome map
AA seq 663 aa AA seqDB search
MAKERKPSKQQPADQDSISSVLTEKRKFPPPPEFSENARISSMDEYEKLYAKAQKDPEKY
WGGIAEEFHWEKKWNSVLDWKPPYAKWFSGGTTNLCYNAVDRHVKSWRKNKAAIIWEGEE
GEQRVLTYGELHRQVSKFANVLKIAGVQPGDRVAIYMGMVPELAIAVLACARVGAVHNVI
FAGFSAHAITERVNDSRAKLIICSDGTRRRGKTINLKDIVDEAIVNTPSVRSVIVLKTTN
EEVHMHDGMDHWWHDLMGLAVDHNDPEFVDAEHPLFILYTSGSTGKPKGILHTTGGYMVH
AANSFKHVFDIKDEDIYWCTADVGWITGHTYLVYGPLLNGATIMMYEGAPNYPQWDRFWD
IINRHKVTILYTAPTAIRAFIRAGDEWVTKHDLSSLRLLGTVGEPINPKAWMWYHTVIGK
EKCPIVDTWWQTETGGILVSPLPGATPTKPGTATRPLPGIMVDVLRKDGKPCKPNEGGYL
VIKQPWPSMLRTIYGDNKRYEDTYWSEFKDIYFTGDGARKDEDGYIWIMGRVDDVVNVSG
HRLGTSEVESALVAHEAVAEAAVVSRPDEIKGNSLIAFVTLKDEYVGDMKLRDDLRGHVA
KEIGPIAKPDEIRWAQGLPKTRSGKIMRRLLRELASTKEIKGDVTTLEDFGVLEQLRGKE
DEE
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaagaaaaccatccaaacaacaaccagccgatcaagactcaatcagttct
gttcttacggaaaagagaaagtttcctcctccccctgaattttcggaaaacgcccgcatt
tcatcaatggacgagtatgaaaaactctacgctaaagcccagaaagatccggaaaaatac
tggggcggcatagccgaagagtttcactgggaaaagaaatggaacagtgttcttgactgg
aaaccgccttatgcgaaatggttttccggcggcacgacaaacctctgttataatgccgtt
gacaggcatgtaaagagctggagaaaaaacaaggccgccataatctgggaaggtgaagaa
ggcgaacagcgtgttctgacctacggtgaactgcaccgtcaggtaagcaaattcgccaat
gtcctgaaaatcgccggcgttcaaccgggagacagggtagccatctacatgggcatggtc
ccggaactggctatcgcagtccttgcatgtgctcgcgtcggagctgtccataatgtgatt
ttcgcagggttttcagctcatgccatcaccgaaagggtcaatgactcgagagcaaagctc
ataatctgctctgacggaacaagaaggcgcggcaaaaccatcaacctcaaggatattgtc
gatgaagccattgtcaacaccccttccgtacgcagcgtcatcgtgctgaaaaccaccaat
gaagaggtacacatgcatgacggcatggatcactggtggcatgatcttatggggctcgct
gtagaccacaatgatcctgagtttgtcgatgcggaacatcccctcttcattctctataca
agcggatcaacaggcaaaccgaaaggaatcctccatacgaccggaggctacatggttcat
gcggcaaactccttcaaacatgttttcgacatcaaggatgaagacatttactggtgtacc
gcagatgtcggctggatcaccggacacacctatctggtttacggcccgttgcttaacggc
gcaaccatcatgatgtacgaaggtgctcccaactacccgcaatgggatcgtttctgggat
atcatcaaccgtcacaaagtcaccattctctacaccgcacccacagcaatccgcgcattt
atccgcgcaggcgacgaatgggtcaccaaacatgatctcagctcattgaggctgctcgga
accgtcggagaaccgatcaaccccaaagcatggatgtggtaccataccgttatcggcaag
gaaaaatgtccgattgtcgatacctggtggcagacagaaaccggcggcatactggtttct
ccgcttcccggagcaacgccgaccaaacccggcacggctacaagaccgcttccgggaatc
atggtggatgtcctgcgcaaggatggcaagccctgcaaaccgaacgaagggggctacctg
gtcatcaagcagccctggccatcaatgcttcgcaccatctacggcgacaacaagcgttat
gaagacacctactggtccgagttcaaggacatatactttactggtgacggcgcccgaaaa
gatgaagacggttatatatggatcatgggccgtgtcgatgacgtcgtcaatgtttccggt
caccgtctcggcacaagtgaagttgaaagcgcccttgtcgcgcacgaggcggttgcagaa
gcggcggtggtcagccgtcctgatgaaatcaagggtaactcccttatcgcgtttgtcacg
ctcaaggacgaatacgtcggcgatatgaaactgcgtgatgatctccgtggacatgtagct
aaagagatcggccctatcgccaaacctgatgaaatcagatgggctcaaggtcttcccaaa
acaagaagcgggaaaatcatgcgacgcctgcttcgtgaacttgcttccacaaaggaaatc
aagggagatgtcactaccctcgaggactttggagtactggaacagcttcgcggaaaggaa
gacgaagagtag

DBGET integrated database retrieval system