KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0550Help
Entry
Cphamn1_0550      CDS       T00709                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphamn1_0550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_0550
   00620 Pyruvate metabolism
    Cphamn1_0550
   00640 Propanoate metabolism
    Cphamn1_0550
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cphamn1_0550
   00680 Methane metabolism
    Cphamn1_0550
Enzymes [BR:cpb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cphamn1_0550
Lipid biosynthesis proteins [BR:cpb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cphamn1_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(579880..581871)
Genome map
AA seq 663 aa AA seqDB search
MAKERKPSKQQPADQDSISSVLTEKRKFPPPPEFSENARISSMDEYEKLYAKAQKDPEKY
WGGIAEEFHWEKKWNSVLDWKPPYAKWFSGGTTNLCYNAVDRHVKSWRKNKAAIIWEGEE
GEQRVLTYGELHRQVSKFANVLKIAGVQPGDRVAIYMGMVPELAIAVLACARVGAVHNVI
FAGFSAHAITERVNDSRAKLIICSDGTRRRGKTINLKDIVDEAIVNTPSVRSVIVLKTTN
EEVHMHDGMDHWWHDLMGLAVDHNDPEFVDAEHPLFILYTSGSTGKPKGILHTTGGYMVH
AANSFKHVFDIKDEDIYWCTADVGWITGHTYLVYGPLLNGATIMMYEGAPNYPQWDRFWD
IINRHKVTILYTAPTAIRAFIRAGDEWVTKHDLSSLRLLGTVGEPINPKAWMWYHTVIGK
EKCPIVDTWWQTETGGILVSPLPGATPTKPGTATRPLPGIMVDVLRKDGKPCKPNEGGYL
VIKQPWPSMLRTIYGDNKRYEDTYWSEFKDIYFTGDGARKDEDGYIWIMGRVDDVVNVSG
HRLGTSEVESALVAHEAVAEAAVVSRPDEIKGNSLIAFVTLKDEYVGDMKLRDDLRGHVA
KEIGPIAKPDEIRWAQGLPKTRSGKIMRRLLRELASTKEIKGDVTTLEDFGVLEQLRGKE
DEE
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaagaaaaccatccaaacaacaaccagccgatcaagactcaatcagttct
gttcttacggaaaagagaaagtttcctcctccccctgaattttcggaaaacgcccgcatt
tcatcaatggacgagtatgaaaaactctacgctaaagcccagaaagatccggaaaaatac
tggggcggcatagccgaagagtttcactgggaaaagaaatggaacagtgttcttgactgg
aaaccgccttatgcgaaatggttttccggcggcacgacaaacctctgttataatgccgtt
gacaggcatgtaaagagctggagaaaaaacaaggccgccataatctgggaaggtgaagaa
ggcgaacagcgtgttctgacctacggtgaactgcaccgtcaggtaagcaaattcgccaat
gtcctgaaaatcgccggcgttcaaccgggagacagggtagccatctacatgggcatggtc
ccggaactggctatcgcagtccttgcatgtgctcgcgtcggagctgtccataatgtgatt
ttcgcagggttttcagctcatgccatcaccgaaagggtcaatgactcgagagcaaagctc
ataatctgctctgacggaacaagaaggcgcggcaaaaccatcaacctcaaggatattgtc
gatgaagccattgtcaacaccccttccgtacgcagcgtcatcgtgctgaaaaccaccaat
gaagaggtacacatgcatgacggcatggatcactggtggcatgatcttatggggctcgct
gtagaccacaatgatcctgagtttgtcgatgcggaacatcccctcttcattctctataca
agcggatcaacaggcaaaccgaaaggaatcctccatacgaccggaggctacatggttcat
gcggcaaactccttcaaacatgttttcgacatcaaggatgaagacatttactggtgtacc
gcagatgtcggctggatcaccggacacacctatctggtttacggcccgttgcttaacggc
gcaaccatcatgatgtacgaaggtgctcccaactacccgcaatgggatcgtttctgggat
atcatcaaccgtcacaaagtcaccattctctacaccgcacccacagcaatccgcgcattt
atccgcgcaggcgacgaatgggtcaccaaacatgatctcagctcattgaggctgctcgga
accgtcggagaaccgatcaaccccaaagcatggatgtggtaccataccgttatcggcaag
gaaaaatgtccgattgtcgatacctggtggcagacagaaaccggcggcatactggtttct
ccgcttcccggagcaacgccgaccaaacccggcacggctacaagaccgcttccgggaatc
atggtggatgtcctgcgcaaggatggcaagccctgcaaaccgaacgaagggggctacctg
gtcatcaagcagccctggccatcaatgcttcgcaccatctacggcgacaacaagcgttat
gaagacacctactggtccgagttcaaggacatatactttactggtgacggcgcccgaaaa
gatgaagacggttatatatggatcatgggccgtgtcgatgacgtcgtcaatgtttccggt
caccgtctcggcacaagtgaagttgaaagcgcccttgtcgcgcacgaggcggttgcagaa
gcggcggtggtcagccgtcctgatgaaatcaagggtaactcccttatcgcgtttgtcacg
ctcaaggacgaatacgtcggcgatatgaaactgcgtgatgatctccgtggacatgtagct
aaagagatcggccctatcgccaaacctgatgaaatcagatgggctcaaggtcttcccaaa
acaagaagcgggaaaatcatgcgacgcctgcttcgtgaacttgcttccacaaaggaaatc
aagggagatgtcactaccctcgaggactttggagtactggaacagcttcgcggaaaggaa
gacgaagagtag

DBGET integrated database retrieval system