KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0550Help
Entry
Cphamn1_0550      CDS       T00709                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cpb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpb00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cpb00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cpb00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:cpb00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:cpb00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(579880..581871)
Genome map
AA seq 663 aa AA seqDB search
MAKERKPSKQQPADQDSISSVLTEKRKFPPPPEFSENARISSMDEYEKLYAKAQKDPEKY
WGGIAEEFHWEKKWNSVLDWKPPYAKWFSGGTTNLCYNAVDRHVKSWRKNKAAIIWEGEE
GEQRVLTYGELHRQVSKFANVLKIAGVQPGDRVAIYMGMVPELAIAVLACARVGAVHNVI
FAGFSAHAITERVNDSRAKLIICSDGTRRRGKTINLKDIVDEAIVNTPSVRSVIVLKTTN
EEVHMHDGMDHWWHDLMGLAVDHNDPEFVDAEHPLFILYTSGSTGKPKGILHTTGGYMVH
AANSFKHVFDIKDEDIYWCTADVGWITGHTYLVYGPLLNGATIMMYEGAPNYPQWDRFWD
IINRHKVTILYTAPTAIRAFIRAGDEWVTKHDLSSLRLLGTVGEPINPKAWMWYHTVIGK
EKCPIVDTWWQTETGGILVSPLPGATPTKPGTATRPLPGIMVDVLRKDGKPCKPNEGGYL
VIKQPWPSMLRTIYGDNKRYEDTYWSEFKDIYFTGDGARKDEDGYIWIMGRVDDVVNVSG
HRLGTSEVESALVAHEAVAEAAVVSRPDEIKGNSLIAFVTLKDEYVGDMKLRDDLRGHVA
KEIGPIAKPDEIRWAQGLPKTRSGKIMRRLLRELASTKEIKGDVTTLEDFGVLEQLRGKE
DEE
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaagaaaaccatccaaacaacaaccagccgatcaagactcaatcagttct
gttcttacggaaaagagaaagtttcctcctccccctgaattttcggaaaacgcccgcatt
tcatcaatggacgagtatgaaaaactctacgctaaagcccagaaagatccggaaaaatac
tggggcggcatagccgaagagtttcactgggaaaagaaatggaacagtgttcttgactgg
aaaccgccttatgcgaaatggttttccggcggcacgacaaacctctgttataatgccgtt
gacaggcatgtaaagagctggagaaaaaacaaggccgccataatctgggaaggtgaagaa
ggcgaacagcgtgttctgacctacggtgaactgcaccgtcaggtaagcaaattcgccaat
gtcctgaaaatcgccggcgttcaaccgggagacagggtagccatctacatgggcatggtc
ccggaactggctatcgcagtccttgcatgtgctcgcgtcggagctgtccataatgtgatt
ttcgcagggttttcagctcatgccatcaccgaaagggtcaatgactcgagagcaaagctc
ataatctgctctgacggaacaagaaggcgcggcaaaaccatcaacctcaaggatattgtc
gatgaagccattgtcaacaccccttccgtacgcagcgtcatcgtgctgaaaaccaccaat
gaagaggtacacatgcatgacggcatggatcactggtggcatgatcttatggggctcgct
gtagaccacaatgatcctgagtttgtcgatgcggaacatcccctcttcattctctataca
agcggatcaacaggcaaaccgaaaggaatcctccatacgaccggaggctacatggttcat
gcggcaaactccttcaaacatgttttcgacatcaaggatgaagacatttactggtgtacc
gcagatgtcggctggatcaccggacacacctatctggtttacggcccgttgcttaacggc
gcaaccatcatgatgtacgaaggtgctcccaactacccgcaatgggatcgtttctgggat
atcatcaaccgtcacaaagtcaccattctctacaccgcacccacagcaatccgcgcattt
atccgcgcaggcgacgaatgggtcaccaaacatgatctcagctcattgaggctgctcgga
accgtcggagaaccgatcaaccccaaagcatggatgtggtaccataccgttatcggcaag
gaaaaatgtccgattgtcgatacctggtggcagacagaaaccggcggcatactggtttct
ccgcttcccggagcaacgccgaccaaacccggcacggctacaagaccgcttccgggaatc
atggtggatgtcctgcgcaaggatggcaagccctgcaaaccgaacgaagggggctacctg
gtcatcaagcagccctggccatcaatgcttcgcaccatctacggcgacaacaagcgttat
gaagacacctactggtccgagttcaaggacatatactttactggtgacggcgcccgaaaa
gatgaagacggttatatatggatcatgggccgtgtcgatgacgtcgtcaatgtttccggt
caccgtctcggcacaagtgaagttgaaagcgcccttgtcgcgcacgaggcggttgcagaa
gcggcggtggtcagccgtcctgatgaaatcaagggtaactcccttatcgcgtttgtcacg
ctcaaggacgaatacgtcggcgatatgaaactgcgtgatgatctccgtggacatgtagct
aaagagatcggccctatcgccaaacctgatgaaatcagatgggctcaaggtcttcccaaa
acaagaagcgggaaaatcatgcgacgcctgcttcgtgaacttgcttccacaaaggaaatc
aagggagatgtcactaccctcgaggactttggagtactggaacagcttcgcggaaaggaa
gacgaagagtag

DBGET integrated database retrieval system