KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0608Help
Entry
Cphamn1_0608      CDS       T00709                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphamn1_0608
   01230 Biosynthesis of amino acids
    Cphamn1_0608
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_0608
   00030 Pentose phosphate pathway
    Cphamn1_0608
   00051 Fructose and mannose metabolism
    Cphamn1_0608
   00052 Galactose metabolism
    Cphamn1_0608
  Energy metabolism
   00680 Methane metabolism
    Cphamn1_0608
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cphamn1_0608
Enzymes [BR:cpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cphamn1_0608
Protein phosphatases and associated proteins [BR:cpb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cphamn1_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(640519..641724)
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVIKGAAFMALSKGIELYVIPNGYAGLYNLIDQETLVRLDRAR
LDQFPGNFAGSEAGHSRVKIKAISNPEKYHRIKEGMSKFELDGLVISGGDDSGSVMVDLS
NNGIQCIHAPKTMDLDLQTYSVGGDSTINRIAQFVQDLKTTGKTHNRILVTEVFGRYAGH
TAFRSGVAAEADCILIPEIPADWDIVYEHIVGRFTGRIRQSDVRSGTYTIVVAEGLKNAD
GTDIVDESAGVDAFGHKKLAGAGKYVCQELKKRLKADPDMPVFMKETGMFVEGIYEIPEI
REIHPGHLVRCGNSSAYDINFGYEAGAAAVILLLEGRSGVTISKVKGRKIEFIESSKAIE
QRHVDLDQVALYESLGVCFGREIMTYNPILREVDGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattggcattttgaccagtggcggagattgcggcggcctgaatgccgtcatc
aagggagccgcatttatggctttgtcgaaaggaattgagttatacgtcattccgaatggt
tatgcagggttgtacaaccttatagatcaggagacgcttgtacgacttgacagggcacgt
ctggaccagtttcccggcaacttcgcgggatccgaggcggggcattcgcgcgttaaaata
aaagctatcagcaaccctgagaaataccaccgtatcaaggaaggaatgagtaagttcgaa
cttgacggcctggttatcagcggtggagacgacagcggcagcgtcatggttgatttgagc
aataacggtattcagtgtattcatgcgccgaaaaccatggatctcgacctgcagacatac
tctgtcggaggcgattcaaccatcaacagaatcgcacagttcgttcaggatctgaaaaca
acgggaaaaacgcataaccgcattctcgtcacggaggtattcggaagatatgcaggtcat
accgccttcagaagcggcgtcgcagcagaggcggattgtatactcattcctgaaataccc
gcagactgggatatcgtctatgagcatattgtcggacgcttcaccggccgcatcaggcag
agcgacgttcgttccggaacctatacaattgttgtcgccgaaggccttaaaaacgccgat
ggaaccgatatagtcgatgaatctgcgggagttgacgcattcgggcacaaaaaacttgcc
ggtgcaggcaagtatgtctgtcaggagttgaagaaaagactgaaagccgatccggatatg
ccggtattcatgaaggaaacaggaatgtttgttgaagggatctatgagattccggaaatc
agggagatccatccgggacaccttgtgcgttgcggaaactcctctgcatatgatatcaac
ttcggctatgaagccggagcggcagccgtaatactgcttttggaaggcagatcaggtgtc
accatttcaaaagtgaaaggccggaaaattgaattcattgaatcaagcaaggctattgaa
caacgccatgtcgaccttgaccaggtcgcgctctatgaatcactcggtgtctgcttcggg
cgggaaatcatgacctataatccgatcctgagagaagttgacggtgtctatgaaagaatt
tattga

DBGET integrated database retrieval system