KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0667Help
Entry
Cphamn1_0667      CDS       T00709                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00020  Citrate cycle (TCA cycle)
cpb00640  Propanoate metabolism
cpb00660  C5-Branched dibasic acid metabolism
cpb00720  Carbon fixation pathways in prokaryotes
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
cpb01120  Microbial metabolism in diverse environments
cpb01130  Biosynthesis of antibiotics
cpb01200  Carbon metabolism
Module
cpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cpb_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
cpb_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cphamn1_0667
   00640 Propanoate metabolism
    Cphamn1_0667
   00660 C5-Branched dibasic acid metabolism
    Cphamn1_0667
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cphamn1_0667
Enzymes [BR:cpb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cphamn1_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF3182 OKR_DC_1_N Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ACE03625
JGI: Cphamn10667
UniProt: B3EN95
Position
complement(698198..699373)
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQGKDILRKFGVSVPKGIVAFSPAEARQAAEQLFEEQESNVVVVKAQIHAGGRGK
AGGVKLAQSPEEAYEIAGQILGATLVTHQTGPEGKEVRRLLVEEGMNIEKEFYVGITLDR
ATSNNVLMVSTEGGMEIEKVAEETPDKILKIQIDPLHGLLGFQARQAAFFLELDGERFKN
GVKFITALYNAYVSIDASLAEINPLVVTAEGRVLALDAKINFDSNALYRHKDFLELRDTG
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDMIQLAGGKPANFLDVGGTASPE
TVTEGFKIIMSDKNVKAILVNIFGGIVRCDRVAAGVIEAAKKVGLNLPVIVRLEGTNAEA
AQTMLDESGLNLISANGLRDAAEKINEALAG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaaggtaaggatatcctgcgcaaattcggggtttccgtacca
aaaggcatcgtcgcattttctcctgctgaagcaaggcaggcggccgaacagctttttgaa
gagcaggaaagcaacgttgtcgtagtcaaagcccagatacatgccgggggaagaggaaaa
gccggtggggtcaaacttgcccaatctccggaagaagcctatgaaatcgccggacagatt
ctcggcgcaaccctggtgacgcaccagacaggcccagagggcaaagaggtcagacgactt
cttgttgaagagggaatgaacatcgaaaaagagttttacgtaggcatcacccttgatcgt
gccacatcgaataacgtgctcatggtttctacggaaggcggcatggaaatcgaaaaagtc
gccgaagagacgccggataaaatcctgaaaatccagatcgatccgctgcacggcctcctt
ggattccaggctcgtcaggctgccttcttccttgaacttgatggtgagaggttcaaaaac
ggcgtcaaattcataaccgcgctctataacgcctatgtctccatagacgcatctctggcg
gaaatcaatccgctggtagttaccgcggaaggccgtgttctggcactcgatgcgaaaatc
aactttgactcaaacgctctctaccgccataaagatttccttgaactcagagataccggt
gaagaggacccgtttgaagttgaagcctcaaaatcaaacctcaactatgtccgtctcgac
ggcaacgtcggctgcatggtcaatggcgcaggtctggcaatgggaacgatggacatgatc
cagttagcaggcggcaagccggccaacttccttgacgtaggcggtacggcaagccctgaa
accgtgacggaaggcttcaaaatcatcatgagtgacaaaaatgtcaaggctatcctcgtt
aacattttcggcggaatcgtgcgttgtgaccgcgtcgcggcaggcgttattgaagctgcc
aaaaaggtaggcctcaaccttcccgtcattgtcaggcttgaaggcaccaacgctgaagca
gcgcagacaatgcttgacgaatccggtctcaaccttatttcggcaaacggactgcgggac
gcggcggaaaaaatcaacgaggcactggcaggatag

DBGET integrated database retrieval system