KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0764Help
Entry
Cphamn1_0764      CDS       T00709                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cphamn1_0764
Enzymes [BR:cpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cphamn1_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
812760..814946
Genome map
AA seq 728 aa AA seqDB search
MQESLSADPKIERLAGTVERIVFHSDDSGFSVLRVRLKGSREPVTVTGCIAAVSAGEFVE
SVGEWINDRTYGLQFKASEVTVVPPATVEGIEKYLASGMVKGVGQHFAKELVRAFGEEVF
SIIEKEPETLLTLPGIGKKRMEMIVDAWKEQQAVRDIMVFLQSHGVGTARAVRIYKTYGD
QAVTIVSSNPYRLVLDIQGIGFKTADAIASKLGTPSDSPVRARAGVRHVLGEISAEGHCA
ATRERLVTDTVALLGVDDQVVDRAIKEEIVNGGLVQDDIKGIPCLYLASLYRAESSVAAS
IRRLIEGEPPWGRIDAQEAVQKVESLTGLVLSASQEEALRLALESKFLVITGGPGVGKTT
LVNAILSIIRSQKLKIALCAPTGRAAKRLTESTGLEAKTIHRLLEFDPHSFDFKHSTGKP
LTADLVVVDESSMIDVTLMSKLLAAVQNSAALILVGDADQLPSVGPGAVLDDVIASDAVP
VVRLTEIFRQAAESEIISNAHRINRGEIPCSGNSERLADFYFVPAEEPDDIRSKLLEVVL
KRIPSTFGLDPVRDIQVLTPMNRGGLGTISLNAALQKELNPNSNRGVVRFGTSYSDGDKV
IQLVNNYDKEVFNGDIGVITSVDEDEKQVIVDFDKRLIEYEFGELDELALAYATSIHKSQ
GSEYPAVVIPLAMQHFLLLRRTLLYTAVTRGKKLVMIIGQQKALGMAVGNSDDSKRVTNL
AEKLRRQW
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatccctttctgctgatcctaaaatagaacggcttgcaggaacggtcgaaagg
atcgtatttcacagtgatgattccggtttcagcgtacttcgtgtcaggcttaaaggcagc
agggagccggtgacggttacgggatgtattgccgctgtctcggcaggagagtttgttgag
agtgtcggggaatggatcaatgaccgaacatacgggctgcagttcaaggccagcgaggtg
acagttgttcctcccgcgactgtcgaggggattgaaaaatatctggcttcgggaatggta
aagggtgtgggacagcattttgccaaagagctggtccgggccttcggagaggaggttttt
tcgattatcgagaaagagccggagacattgctgacgttgccggggattggcaaaaagcgc
atggagatgattgtcgatgcctggaaggagcagcaggcggtgagagatatcatggtgttc
ctgcagtctcacggcgtcggcaccgccagagcggttcgtatctataaaacctatggtgat
caggctgtcacgatagtgagcagcaatccgtacaggttggtgctggatattcagggaatc
ggtttcaaaacagctgacgcaatcgcctcgaaactgggtacaccctccgattcaccggtt
cgcgctcgcgcaggagttcggcatgtactgggagagatatccgctgaaggacattgtgcc
gcgacaagggaaagacttgttaccgatacagtagcgctgctcggggttgatgatcaggtt
gtcgatagggcgataaaagaggagatcgttaacggcggccttgtacaggatgatatcaaa
ggcattccctgtctttatcttgcttctctctacagagcggaaagtagtgtagccgcttca
atcaggagactgatcgaaggtgaacctccctggggcaggatcgatgcacaagaggcggtg
cagaaggttgaatctcttaccgggcttgtgctttcagcttcacaggaagaggccctcagg
cttgcgcttgaaagcaagtttcttgtgattaccggtggtccgggggtggggaagacaacg
ctggtgaatgccattctctcgattatccgttcacaaaaactgaagatagcgctttgcgcg
cctacgggcagagcggcaaagaggttgacggaatccacgggcctcgaggcaaaaaccatt
catcgtctgcttgagtttgatcctcattcctttgatttcaaacatagtacaggcaagccc
ctgacagcagaccttgtcgtcgttgatgaatcttcgatgatcgatgtgacactgatgagc
aagctgcttgccgcagtgcagaatagcgcagccctgatactggtgggggatgccgatcag
cttccttctgtcggcccgggagctgttcttgacgacgtgatcgcgtcagacgctgtacct
gttgtcaggcttacggagattttcaggcaggcagccgagtcggaaattatttccaatgct
cacaggatcaaccggggcgagataccctgtagcggcaatagtgaacggcttgctgatttc
tattttgttccggcagaagagccggacgatattcgttccaagctgcttgaagtcgttctc
aaacgtattccttcaacgttcggtttagatcctgtcagagatattcaggtgctgacgccg
atgaaccgtggagggctcggaacaatttcgctcaatgccgcgctgcaaaaggaactgaac
ccgaacagcaatcgcggtgtcgttcgtttcggcaccagctattcggatggcgacaaagtt
attcagttggtcaacaattatgataaagaggtgttcaatggagatatcggggtaatcacc
tctgttgatgaagatgaaaaacaggtgatcgtcgattttgacaaacgattgatcgagtat
gagttcggtgagctcgatgagcttgcccttgcgtatgcgaccagtattcataaaagccag
ggctcggagtatcccgctgtggttatacctcttgccatgcagcatttcctgctgctccgc
aggacccttctctacactgcagtgaccagggggaaaaaacttgtcatgattatcggccag
caaaaggcgctcggtatggctgtgggaaacagtgatgattcaaaaagagtgactaatctc
gcagagaagctgcgcaggcagtggtag

DBGET integrated database retrieval system