KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0776Help
Entry
Cphamn1_0776      CDS       T00709                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00260  Glycine, serine and threonine metabolism
cpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
cpb01130  Biosynthesis of antibiotics
cpb01230  Biosynthesis of amino acids
Module
cpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphamn1_0776
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphamn1_0776
Enzymes [BR:cpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cphamn1_0776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACE03727
JGI: Cphamn10776
UniProt: B3ENV0
Position
complement(828873..830075)
Genome map
AA seq 400 aa AA seqDB search
MTQSVYTAPDDTGHFGKYGGKFIPETLIKNASDLEDEYKKAKEDQAFWNEYEKLLRHYVG
RPTPLYHAEHLSRHIGGAQIYLKREDLCHTGAHKINNALGQALLARRMGKKRIIAETGAG
QHGVATATVCALFDLDCIVYMGAEDIRRQAPNVARMKLLGAEVRPVENGTKTLKDATSEA
IRDWINNPEETFYIIGSVVGMHPYPMMVRDFQAVIGRETRQQILEQTGRLPDVITACVGG
GSNAIGMFYAFLDSAGDIEMVGVEAAGEGLEALHAASLTKGKKGVLHGAMMKILQDDFGQ
VSEAHSISAGLDYPGVGPEHCHLQELGIVHYTSATDTQALEALRLLAEKEGIICALESAH
AVHYATVRAAEMPKESMLIVNLSGRGDKDMETIMNRLELK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacacagtcagtatatactgcccctgacgacacaggacacttcgggaaatatggagga
aagttcatcccggaaacccttatcaaaaacgcctcggaccttgaagacgaatacaaaaaa
gcaaaagaagatcaggctttctggaatgaatacgagaagcttctccgtcactatgtaggt
cgaccgacaccgctctaccacgctgaacatctgagcagacatatcggaggagcgcagata
tacctgaaacgtgaggatctgtgccataccggagcacataagatcaacaatgctctcggc
caggctcttctggcaaggcgaatggggaaaaaaaggatcattgccgaaaccggcgccggc
cagcatggcgtagcaaccgctacggtatgtgctctcttcgatttagactgtattgtgtac
atgggcgcggaggatatcagacgacaggcccctaacgttgcccgaatgaagctgctcgga
gcagaggtgcgcccggtcgaaaacggcacaaaaacgctcaaggacgccaccagtgaagct
attcgcgactggatcaacaatcctgaagagaccttctatatcataggatctgtcgtcggc
atgcacccctatcccatgatggtcagggatttccaggcggtcatcggccgtgaaaccaga
cagcagatacttgagcagaccgggagacttccggatgtcatcaccgcgtgcgtaggcggt
ggcagcaatgcgatcgggatgttctatgcatttctggattctgccggggatattgaaatg
gtcggcgtagaagccgccggtgaaggacttgaagccttgcatgccgcctccctgaccaaa
ggaaaaaaaggagtgctccacggggcaatgatgaaaatcctgcaggatgacttcggccag
gtcagcgaagcacactcgatatctgccggacttgactaccccggcgttggaccggaacac
tgccatctgcaggaactcggcatcgttcattacacatcagccaccgatacccaggcactt
gaagccctgagactgcttgcagaaaaagaagggatcatatgcgccctggaatcagcacat
gccgttcactatgcaaccgttcgtgctgcagaaatgcccaaagaaagcatgctgatcgtc
aacctgtccggcagaggcgacaaggatatggaaaccattatgaaccgtctcgaactgaag
tga

DBGET integrated database retrieval system