KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0786Help
Entry
Cphamn1_0786      CDS       T00709                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00260  Glycine, serine and threonine metabolism
cpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
cpb01130  Biosynthesis of antibiotics
cpb01230  Biosynthesis of amino acids
Module
cpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphamn1_0786
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphamn1_0786
Enzymes [BR:cpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cphamn1_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: ACE03737
JGI: Cphamn10786
UniProt: B3ENW0
Position
841742..842548
Genome map
AA seq 268 aa AA seqDB search
MAQNRVSRLMQEDRKFLIAYYMPEFPLPGSTLPVLEALQKSGVDIIELGMPYSDPIGDGP
VIQDAAHTAIGNGVHIAGILDLVRKARAGEGCEKITVPLLLMGYCSPLIAYGGDCFLSDA
SEAGVDGLLIPDLPPEEAEDFLFRARGFGLSVIFFISPETPPERIGMIDGLSTDFSYCFA
VNATTGTAKLAGADSERDIESYLRRVREHTKKKFVVGFGIKDRARVEKMWNLADGAVVGT
ALLQAIRNASTPEEVALMTAEFWKTLKS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaacagagtttcccgtttaatgcaggaggatcgaaaattcctcattgcctac
tatatgccggagtttcctcttcccggatcaacacttcccgttcttgaggctttgcagaag
agcggggttgatatcattgagcttggaatgccctattccgatcctattggcgacggccct
gtcattcaggatgctgctcacacggcgataggtaacggtgtccatattgctggtattctt
gacctggtgagaaaggccagggcaggggaggggtgtgaaaagatcaccgttcctcttctg
ctcatgggttattgcagtccccttatcgcctatggcggggattgctttctcagtgatgct
tcagaagccggagtggacggtttgctgattcccgatctgccgccggaggaagccgaagat
tttcttttcagggccaggggattcgggctttccgtgatctttttcatttcgccggagact
cctcctgaacgcatagggatgatcgatggtttatccacggacttttcctactgttttgcg
gtcaatgcgactaccggcacagcgaaacttgccggtgcagacagcgaaagggatattgaa
agctatctgcgcagagtcagggagcatacaaaaaagaaatttgttgtcggttttggaata
aaggacagggcacgtgtggaaaagatgtggaaccttgccgatggtgcggttgtcggaacc
gcgcttctccaggccatcaggaatgcttcaacccctgaggaggttgcccttatgacggct
gaattctggaagacactcaagtcttaa

DBGET integrated database retrieval system