KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0786Help
Entry
Cphamn1_0786      CDS       T00709                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cphamn1_0786 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cphamn1_0786 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cphamn1_0786 (trpA)
Enzymes [BR:cpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cphamn1_0786 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
841742..842548
Genome map
AA seq 268 aa AA seqDB search
MAQNRVSRLMQEDRKFLIAYYMPEFPLPGSTLPVLEALQKSGVDIIELGMPYSDPIGDGP
VIQDAAHTAIGNGVHIAGILDLVRKARAGEGCEKITVPLLLMGYCSPLIAYGGDCFLSDA
SEAGVDGLLIPDLPPEEAEDFLFRARGFGLSVIFFISPETPPERIGMIDGLSTDFSYCFA
VNATTGTAKLAGADSERDIESYLRRVREHTKKKFVVGFGIKDRARVEKMWNLADGAVVGT
ALLQAIRNASTPEEVALMTAEFWKTLKS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaacagagtttcccgtttaatgcaggaggatcgaaaattcctcattgcctac
tatatgccggagtttcctcttcccggatcaacacttcccgttcttgaggctttgcagaag
agcggggttgatatcattgagcttggaatgccctattccgatcctattggcgacggccct
gtcattcaggatgctgctcacacggcgataggtaacggtgtccatattgctggtattctt
gacctggtgagaaaggccagggcaggggaggggtgtgaaaagatcaccgttcctcttctg
ctcatgggttattgcagtccccttatcgcctatggcggggattgctttctcagtgatgct
tcagaagccggagtggacggtttgctgattcccgatctgccgccggaggaagccgaagat
tttcttttcagggccaggggattcgggctttccgtgatctttttcatttcgccggagact
cctcctgaacgcatagggatgatcgatggtttatccacggacttttcctactgttttgcg
gtcaatgcgactaccggcacagcgaaacttgccggtgcagacagcgaaagggatattgaa
agctatctgcgcagagtcagggagcatacaaaaaagaaatttgttgtcggttttggaata
aaggacagggcacgtgtggaaaagatgtggaaccttgccgatggtgcggttgtcggaacc
gcgcttctccaggccatcaggaatgcttcaacccctgaggaggttgcccttatgacggct
gaattctggaagacactcaagtcttaa

DBGET integrated database retrieval system