KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0894Help
Entry
Cphamn1_0894      CDS       T00709                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00330  Arginine and proline metabolism
cpb00332  Carbapenem biosynthesis
cpb01100  Metabolic pathways
cpb01130  Biosynthesis of antibiotics
cpb01230  Biosynthesis of amino acids
Module
cpb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cphamn1_0894
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cphamn1_0894
Enzymes [BR:cpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cphamn1_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACE03839
JGI: Cphamn10894
UniProt: B3EPG1
Position
complement(967723..968808)
Genome map
AA seq 361 aa AA seqDB search
MSDPLYQKIVIKVGTNVITDNRGELDLQILEELVSQISELRSRGVEVFLVSSGAVAAGRA
KVTLNEDLSPIAARQVLSSTGQIRLINTYTDLFEKHALKIAQILVTKSDFRDRQHYLNIR
TCLESLMKYDIIPVINENDAVSVTELMFTDNDELSGLIASMMHVDAYIILSHIDGLFDLS
GDEKPPRLITSVDIATEHFHQYIKPGKSEFGRGGMLTKCHIAQKLSRFGIAVHIANGQTP
GILLDLLDGKAAGTRFVPQKPVYGRKRWIAHSEGLEKGAVTINTGAEKALRSQERANSLL
PVGIESVLGAFYKGDIIRICSENEETIGYGMARYSSEETKELMGKKGAKPLIHYDYLYLM
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacccgctttatcagaaaattgtcatcaaggtaggcacgaatgtcatcaccgac
aatcgtggtgaactggatctgcagatactcgaagagcttgtatctcaaatctccgagctg
cgcagccgtggcgtggaagtgtttcttgtctcttcaggagcggtagcagccggccgggcc
aaagtcacgctcaatgaagatctttcgccgatagcagcccgacaggtactctcgtcgacc
ggacagatacggcttatcaatacctacaccgacctttttgaaaagcatgctctgaaaatc
gctcagatacttgtcaccaaaagtgattttcgtgaccggcagcactatctgaatatcagg
acctgcctcgaatcactgatgaaatacgatatcattcccgtaataaacgagaatgacgcc
gtctctgttacagaactcatgtttactgacaacgacgagctttcagggctcatcgcctca
atgatgcatgtagacgcctacatcattctctcgcatatcgacgggctttttgacctgtcc
ggtgatgagaaaccgcctcgtctgattacttccgtcgacattgcaaccgagcatttccat
cagtatatcaaaccgggaaaatcggagttcggaagaggcggcatgctgaccaaatgccat
atcgcccagaaactctccagattcggtatagccgttcacatcgccaacggacagaccccc
ggcatcctgctcgaccttctcgacggcaaagctgcgggaaccaggtttgtccctcaaaaa
ccggtctacggcagaaaaaggtggatagcgcacagtgaaggacttgaaaaaggagctgta
accatcaacaccggagcagaaaaagccctccgctctcaggaaagagctaacagccttttg
cctgtaggcatcgaatcggtcttaggagcattttacaagggtgatattatcagaatctgc
tctgaaaacgaagaaaccatcggttacggtatggcacgatacagttcagaagagacaaaa
gagctcatgggaaaaaaaggtgcaaagcccctgatccattacgactacctctacctcatg
ccgtga

DBGET integrated database retrieval system