KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0908Help
Entry
Cphamn1_0908      CDS       T00709                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cphamn1_0908 (tpiA)
   01230 Biosynthesis of amino acids
    Cphamn1_0908 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_0908 (tpiA)
   00051 Fructose and mannose metabolism
    Cphamn1_0908 (tpiA)
   00562 Inositol phosphate metabolism
    Cphamn1_0908 (tpiA)
Enzymes [BR:cpb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cphamn1_0908 (tpiA)
Exosome [BR:cpb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cphamn1_0908 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cphamn1_0908 (tpiA)
  Exosomal proteins of melanoma cells
   Cphamn1_0908 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
982279..983031
Genome map
AA seq 250 aa AA seqDB search
MRKKIVVGNWKMNKNVAEGVALASSILENLDGGKMACEVGIAPAYPVLSEVGRVIEGSDI
CLVAQNCHYEDEGAYTGEVSVRMLDSLGCSYIIVGHSERRQYFGETNRTVNLRLKKALEG
GMRVILCIGETLEEREAGVTDAIVTAQVREGLADIEDLGNVVLAYEPVWAIGTGKTATPE
QADAVHASIRATISDMYGEADAEDIRIQYGGSVKPSNAVELFGMPNIDGGLIGGASLKAD
DFVAIVNAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaattgttgttggtaactggaaaatgaacaagaatgtcgcagaaggcgtg
gcgctcgcttcgtcgattcttgaaaatcttgatggcggaaagatggcctgtgaggtaggt
attgcgcctgcatatccggtgctttcagaggtagggagagtcattgagggaagtgatatt
tgtcttgtggctcagaattgccactatgaagatgagggagcctataccggtgaggtatca
gtgcgtatgcttgattctctcggatgttcatacattatagtcggtcactcggaacgcaga
cagtatttcggtgaaaccaaccggacagtcaacctcaggctgaaaaaagctctggagggc
ggaatgcgggtgattctgtgtatcggtgaaacccttgaagagagggaggccggtgtgact
gacgctatcgtaaccgcccaggtaagggaagggcttgcagatatagaggatcttggtaac
gttgtgcttgcctatgagccggtgtgggctatcgggacgggaaagacggcaactcccgaa
caggctgacgcggtgcatgcttccatacgtgcgaccataagcgatatgtatggagaggcc
gatgcagaagacatccggattcagtatggcggcagcgtgaagccatccaatgctgtggaa
cttttcggtatgcccaatatagacggaggacttattggcggagccagcctcaaggccgac
gatttcgttgccatcgtcaatgcagccggttag

DBGET integrated database retrieval system