KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0908Help
Entry
Cphamn1_0908      CDS       T00709                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00010  Glycolysis / Gluconeogenesis
cpb00051  Fructose and mannose metabolism
cpb00562  Inositol phosphate metabolism
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
cpb01120  Microbial metabolism in diverse environments
cpb01130  Biosynthesis of antibiotics
cpb01200  Carbon metabolism
cpb01230  Biosynthesis of amino acids
Module
cpb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cphamn1_0908
   00051 Fructose and mannose metabolism
    Cphamn1_0908
   00562 Inositol phosphate metabolism
    Cphamn1_0908
Enzymes [BR:cpb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cphamn1_0908
Exosome [BR:cpb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cphamn1_0908
  Exosomal proteins of bladder cancer cells
   Cphamn1_0908
  Exosomal proteins of melanoma cells
   Cphamn1_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACE03853
JGI: Cphamn10908
UniProt: B3EPH5
Position
982279..983031
Genome map
AA seq 250 aa AA seqDB search
MRKKIVVGNWKMNKNVAEGVALASSILENLDGGKMACEVGIAPAYPVLSEVGRVIEGSDI
CLVAQNCHYEDEGAYTGEVSVRMLDSLGCSYIIVGHSERRQYFGETNRTVNLRLKKALEG
GMRVILCIGETLEEREAGVTDAIVTAQVREGLADIEDLGNVVLAYEPVWAIGTGKTATPE
QADAVHASIRATISDMYGEADAEDIRIQYGGSVKPSNAVELFGMPNIDGGLIGGASLKAD
DFVAIVNAAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaattgttgttggtaactggaaaatgaacaagaatgtcgcagaaggcgtg
gcgctcgcttcgtcgattcttgaaaatcttgatggcggaaagatggcctgtgaggtaggt
attgcgcctgcatatccggtgctttcagaggtagggagagtcattgagggaagtgatatt
tgtcttgtggctcagaattgccactatgaagatgagggagcctataccggtgaggtatca
gtgcgtatgcttgattctctcggatgttcatacattatagtcggtcactcggaacgcaga
cagtatttcggtgaaaccaaccggacagtcaacctcaggctgaaaaaagctctggagggc
ggaatgcgggtgattctgtgtatcggtgaaacccttgaagagagggaggccggtgtgact
gacgctatcgtaaccgcccaggtaagggaagggcttgcagatatagaggatcttggtaac
gttgtgcttgcctatgagccggtgtgggctatcgggacgggaaagacggcaactcccgaa
caggctgacgcggtgcatgcttccatacgtgcgaccataagcgatatgtatggagaggcc
gatgcagaagacatccggattcagtatggcggcagcgtgaagccatccaatgctgtggaa
cttttcggtatgcccaatatagacggaggacttattggcggagccagcctcaaggccgac
gatttcgttgccatcgtcaatgcagccggttag

DBGET integrated database retrieval system