KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0926Help
Entry
Cphamn1_0926      CDS       T00709                                 

Definition
(GenBank) amine oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00860  Porphyrin and chlorophyll metabolism
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cphamn1_0926
Enzymes [BR:cpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cphamn1_0926
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Cphamn1_0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 HI0933_like FAD_oxidored GIDA Pyr_redox Thi4 Pyr_redox_3 MCRA FAD_binding_2 AlaDh_PNT_C FAD_binding_3 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACE03871
JGI: Cphamn10926
UniProt: B3EPJ3
Position
1001584..1002891
Genome map
AA seq 435 aa AA seqDB search
MSRVAVIGGGISGIATAYYLQQHGAEVDLYESGRSIGGRIGSESLDGRFVDFGGKNIGRK
YSRFRDFVTALGGLDFEYFGFNTSQVVGGRVISLNKEKSRLRNLLRVFSLAGPGGVMKLM
PMIQAVRKDLEQGFLNTPYFNAIADRYDDRSLASFFPESCVDHLVRPVTVRMNGAEPDEC
YPGNFGSNLALVLDSYEQLEQGMQALLQRFTQYSKSVKFFIGHEVRVCSFSDEKIVLHYA
AGSESHSAEYSKVVVALPAVQAAALFQSSIPELASLLDRVTYFPVAVGIAKYHDAVFRGV
QRAMVFDNSCSISNAGAYGINDLNLVRFTFSGQTARTVIDSETDPEYAVSLAEDTIAPYF
NINNNTREAFVYRYVSPGLCAYSPFHYKLLQQIEQQLKGFRGLVLTGDYFRGASIEACFK
GAQEAIQKFMTGAGS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagttgccgttatcggtggtggaatatcgggtattgccaccgcatattatctt
cagcagcatggcgcagaagtggatctttacgagtcaggccgcagtattggaggcaggatc
ggcagtgagagccttgacgggagatttgtggattttggaggtaagaatataggacggaag
tatagcaggtttcgcgatttcgtaacggcgcttgggggactggattttgagtatttcggc
tttaatacttcgcaggttgtgggtggtcgggttatcagtctcaacaaggaaaaatcacga
ttgcgcaatcttctgcgagttttctctctggcaggtcccggcggagtcatgaaacttatg
cctatgattcaggcggtgcgcaaggatttggagcagggttttttgaatacaccgtatttc
aacgcgatcgcagatcgttatgatgacagatccctggcttctttttttcccgaatcatgt
gtcgaccatcttgttcggccagtaacggtcagaatgaacggagcagagccggatgagtgc
tatcctggtaattttggttcgaatctggcgttggtacttgatagttatgagcagcttgag
cagggtatgcaggcactacttcagcgttttacgcagtattcaaaatcagtgaaatttttt
atcgggcatgaagtcagggtttgttcgttcagtgatgaaaaaattgtattgcactatgct
gccggttccgaaagtcatagcgcagagtacagcaaagtagttgttgctcttccagcggtt
caagccgctgcgctctttcagagttccattcctgaactggcgtcattacttgaccgtgtg
acatattttccggttgctgtaggcatagcaaagtatcatgatgctgttttcaggggagtt
cagagagcaatggtgtttgacaattcttgttctataagcaatgcaggggcctatggaatc
aatgacttgaacctggttcgttttacattcagcggtcaaacggcccgcactgttattgat
tctgaaacagacccggaatacgcggtttctcttgcggaagatacaatcgccccgtatttt
aatattaacaacaatacgcgagaagcttttgtttaccgctatgtttcgcctggtctttgc
gcatattccccttttcattacaaattgctgcaacagatcgaacaacagctaaaagggttc
agaggccttgttctcacaggtgattattttcggggagcctccattgaagcgtgtttcaaa
ggggcacaagaagcaattcagaagtttatgacgggagcaggctcgtga

DBGET integrated database retrieval system