KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_0926Help
Entry
Cphamn1_0926      CDS       T00709                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cphamn1_0926
Enzymes [BR:cpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cphamn1_0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1001584..1002891
Genome map
AA seq 435 aa AA seqDB search
MSRVAVIGGGISGIATAYYLQQHGAEVDLYESGRSIGGRIGSESLDGRFVDFGGKNIGRK
YSRFRDFVTALGGLDFEYFGFNTSQVVGGRVISLNKEKSRLRNLLRVFSLAGPGGVMKLM
PMIQAVRKDLEQGFLNTPYFNAIADRYDDRSLASFFPESCVDHLVRPVTVRMNGAEPDEC
YPGNFGSNLALVLDSYEQLEQGMQALLQRFTQYSKSVKFFIGHEVRVCSFSDEKIVLHYA
AGSESHSAEYSKVVVALPAVQAAALFQSSIPELASLLDRVTYFPVAVGIAKYHDAVFRGV
QRAMVFDNSCSISNAGAYGINDLNLVRFTFSGQTARTVIDSETDPEYAVSLAEDTIAPYF
NINNNTREAFVYRYVSPGLCAYSPFHYKLLQQIEQQLKGFRGLVLTGDYFRGASIEACFK
GAQEAIQKFMTGAGS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagttgccgttatcggtggtggaatatcgggtattgccaccgcatattatctt
cagcagcatggcgcagaagtggatctttacgagtcaggccgcagtattggaggcaggatc
ggcagtgagagccttgacgggagatttgtggattttggaggtaagaatataggacggaag
tatagcaggtttcgcgatttcgtaacggcgcttgggggactggattttgagtatttcggc
tttaatacttcgcaggttgtgggtggtcgggttatcagtctcaacaaggaaaaatcacga
ttgcgcaatcttctgcgagttttctctctggcaggtcccggcggagtcatgaaacttatg
cctatgattcaggcggtgcgcaaggatttggagcagggttttttgaatacaccgtatttc
aacgcgatcgcagatcgttatgatgacagatccctggcttctttttttcccgaatcatgt
gtcgaccatcttgttcggccagtaacggtcagaatgaacggagcagagccggatgagtgc
tatcctggtaattttggttcgaatctggcgttggtacttgatagttatgagcagcttgag
cagggtatgcaggcactacttcagcgttttacgcagtattcaaaatcagtgaaatttttt
atcgggcatgaagtcagggtttgttcgttcagtgatgaaaaaattgtattgcactatgct
gccggttccgaaagtcatagcgcagagtacagcaaagtagttgttgctcttccagcggtt
caagccgctgcgctctttcagagttccattcctgaactggcgtcattacttgaccgtgtg
acatattttccggttgctgtaggcatagcaaagtatcatgatgctgttttcaggggagtt
cagagagcaatggtgtttgacaattcttgttctataagcaatgcaggggcctatggaatc
aatgacttgaacctggttcgttttacattcagcggtcaaacggcccgcactgttattgat
tctgaaacagacccggaatacgcggtttctcttgcggaagatacaatcgccccgtatttt
aatattaacaacaatacgcgagaagcttttgtttaccgctatgtttcgcctggtctttgc
gcatattccccttttcattacaaattgctgcaacagatcgaacaacagctaaaagggttc
agaggccttgttctcacaggtgattattttcggggagcctccattgaagcgtgtttcaaa
ggggcacaagaagcaattcagaagtttatgacgggagcaggctcgtga

DBGET integrated database retrieval system