KEGG   Chlorobium phaeobacteroides BS1: Cphamn1_1046Help
Entry
Cphamn1_1046      CDS       T00709                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cpb  Chlorobium phaeobacteroides BS1
Pathway
cpb00860  Porphyrin and chlorophyll metabolism
cpb01100  Metabolic pathways
cpb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cphamn1_1046
Enzymes [BR:cpb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cphamn1_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM AAA_33 AAA_22 AAA Sigma54_activat AAA_29 AAA_18 DUF815 GTP_EFTU AAA_28 AAA_30 FtsK_SpoIIIE ABC_tran RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ACE03987
JGI: Cphamn11046
UniProt: B3EQ55
Position
1130178..1131329
Genome map
AA seq 383 aa AA seqDB search
MTQTASAAKKTASTKAKSGSVAAKASGPKKARTKKKQGTAFPFTAIVGQEEMKLSLILNI
IDPRIGGVLVMGHRGTGKSTTVRALAEVLPMIERVKDDVYNRSVSDYIEAEKPKKGAKAM
TPEDMTIEDIPVPVVDLPLGATEDRVCGTIDIEQALTSGVKAFEPGLLAQSNRGFLYIDE
VNLLDDHLVDVLLDVAASGRNVVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGLH
ARIITILDVAKRVEIVKRRHEYDDDPQAFLKKWTREQNKLQKRILQAKELLPEVTMSDEV
LTDVAKLCMQLGIDGHRGELTITRTANAFAAFNGDKVVTIEHVREIAGLCLRHRLRKDPL
EVMDPGEKIDRELAKVLGEVEEV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaactgcttcagctgcaaagaaaacagcaagtacgaaagcaaagtccggttca
gttgccgccaaggcttccggcccaaagaaagcgagaacaaagaagaagcaagggacggcg
tttcctttcacggcaatcgtaggtcaggaagaaatgaaactcagcctgatactgaatatc
atcgatccgaggattggcggtgtgctcgtgatgggccacaggggaaccggtaaaagtact
actgtccgggcgcttgcagaggtacttcctatgattgaacgagtcaaggacgatgtttac
aaccgttctgtttctgattatatcgaggctgaaaagccgaagaaaggcgcaaaggcgatg
actcctgaagatatgaccatagaggatattcctgtgcctgttgtcgatcttcctctcggc
gcgactgaagaccgtgtttgtggtaccatcgatattgaacaagcgcttacaagcggcgtc
aaggcttttgagcctggacttcttgctcagtccaaccggggatttctttatatcgacgaa
gtgaaccttctcgatgaccatcttgtggacgtactgcttgatgttgctgccagcggcagg
aatgtggttgaacgtgaaggaatcagtattcgccatccggcacgattcgttcttgtcggg
tcgggtaaccctgaagagggtgaactgagacctcagctgcttgaccgtttcggactgcac
gcgaggattatcactattctcgatgttgccaagagagttgaaattgtgaaaagacggcac
gagtatgatgatgacccgcaggcttttttgaaaaaatggacgcgtgaacagaataaactg
cagaaaaggattcttcaggcaaaggaattgctacctgaagttaccatgagtgacgaagta
cttactgatgtcgcaaaactttgtatgcagctcggtatcgacgggcatcgcggtgagctg
acgatcaccagaacagccaacgcttttgcggcgttcaatggcgacaaggtggtgaccatc
gagcatgttcgggagattgcagggctttgcttgcggcatcgcttgcgcaaagatccgctg
gaggttatggatccgggtgaaaaaatcgatcgtgaacttgctaaagtacttggagaagta
gaagaagtataa

DBGET integrated database retrieval system